DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and DIP-theta

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:233 Identity:59/233 - (25%)
Similarity:90/233 - (38%) Gaps:65/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIK 125
            :|:|..|.:.|.|.|.|.:|....:||:|.....|||:..:..|.:.|...: |.:...|.|:|:
  Fly   137 QNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSIT-HAEKRAWILRIR 200

  Fly   126 WAQQRDAGVYECQISTQPVRSYSVNLNIV---DLIDAETSDIMQQYYNDDAFYIAENRVYQSSND 187
            ..::.|.|.|.|||:|.|::|....|::|   |::|                             
  Fly   201 DVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILD----------------------------- 236

  Fly   188 EFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGG 252
                         .||:|     |:.:.:||.:.|.|....||.|.  |.|..:         ||
  Fly   237 -------------YPTST-----DMVIREGSNVTLKCAATGSPTPT--ITWRRE---------GG 272

  Fly   253 RLKFKTIKSEETK---SILLIYDADLLHSGKYSCYPSN 287
            .|......:|...   |.|.|...:.|:.|.|.|..||
  Fly   273 ELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 26/79 (33%)
IG_like 210..297 CDD:214653 23/81 (28%)
IGc2 217..287 CDD:197706 20/72 (28%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 30/93 (32%)
IG_like 137..230 CDD:214653 30/93 (32%)
IG_like 240..324 CDD:214653 24/87 (28%)
IGc2 247..310 CDD:197706 20/73 (27%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.