DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and DIP-beta

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:406 Identity:96/406 - (23%)
Similarity:148/406 - (36%) Gaps:112/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EPYFDLTMP-RNITSLVGKSAYLGCRVKHLGN-----------KTVAWIRHRDLHILTVGTYTYT 104
            ||  |..:| .|:|...|:.|...|.|.:||.           ..||||:.....||.:..:..|
  Fly    97 EP--DFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVIT 159

  Fly   105 TDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIV---DLIDAETSDIMQ 166
            .:.|.... |.|.:.|||.|:..:..|||.|.||::|.|::..:..|.:|   |:|:.|||.   
  Fly   160 NNDRLSVQ-HNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSG--- 220

  Fly   167 QYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPE 231
                                                        |:.|.:|.:..|.|..:..|:
  Fly   221 --------------------------------------------DMMVPEGGSAKLVCRARGHPK 241

  Fly   232 PPTHIFWYHQD--KVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN------T 288
            |  .|.|..:|  ::::...|..:.|.::::.|    :|.:........|.|.|..||      :
  Fly   242 P--KITWRREDGREIIARNGSHQKTKAQSVEGE----MLTLSKITRSEMGAYMCIASNGVPPTVS 300

  Fly   289 EIASIRVHVLQGERPEAMQTN---AAPAA--VALAC------WSCHFGQATQAVRVISTMVAALV 342
            :...::||.    .|.....|   .||..  |.|.|      .:.::.|......:|:....||.
  Fly   301 KRMKLQVHF----HPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALT 361

  Fly   343 LLE----ACSSLL----LQSGGGGG--CPGGGSPAGGMPT-RVREIREKPLTNSLLDPKIPSTTS 396
            ..|    |...:|    |||...||  |....|......| |:.|: |:|....|.|..:...:.
  Fly   362 EKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEM-ERPGKKILRDDDLNEVSK 425

  Fly   397 AE------RVNNGSRN 406
            .|      |..:||||
  Fly   426 NEVVQKDTRSEDGSRN 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 28/90 (31%)
IG_like 210..297 CDD:214653 20/94 (21%)
IGc2 217..287 CDD:197706 15/71 (21%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 34/113 (30%)
ig 102..195 CDD:278476 29/93 (31%)
IG_like 219..307 CDD:214653 20/140 (14%)
Ig 221..307 CDD:299845 19/91 (21%)
Ig 311..404 CDD:299845 22/92 (24%)
IG_like 327..405 CDD:214653 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.