DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and DIP-beta

DIOPT Version :10

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:406 Identity:96/406 - (23%)
Similarity:148/406 - (36%) Gaps:112/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EPYFDLTMP-RNITSLVGKSAYLGCRVKHLGN-----------KTVAWIRHRDLHILTVGTYTYT 104
            ||  |..:| .|:|...|:.|...|.|.:||.           ..||||:.....||.:..:..|
  Fly    97 EP--DFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVIT 159

  Fly   105 TDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIV---DLIDAETSDIMQ 166
            .:.|.... |.|.:.|||.|:..:..|||.|.||::|.|::..:..|.:|   |:|:.|||.   
  Fly   160 NNDRLSVQ-HNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSG--- 220

  Fly   167 QYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPE 231
                                                        |:.|.:|.:..|.|..:..|:
  Fly   221 --------------------------------------------DMMVPEGGSAKLVCRARGHPK 241

  Fly   232 PPTHIFWYHQD--KVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN------T 288
            |  .|.|..:|  ::::...|..:.|.::::.|    :|.:........|.|.|..||      :
  Fly   242 P--KITWRREDGREIIARNGSHQKTKAQSVEGE----MLTLSKITRSEMGAYMCIASNGVPPTVS 300

  Fly   289 EIASIRVHVLQGERPEAMQTN---AAPAA--VALAC------WSCHFGQATQAVRVISTMVAALV 342
            :...::||.    .|.....|   .||..  |.|.|      .:.::.|......:|:....||.
  Fly   301 KRMKLQVHF----HPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALT 361

  Fly   343 LLE----ACSSLL----LQSGGGGG--CPGGGSPAGGMPT-RVREIREKPLTNSLLDPKIPSTTS 396
            ..|    |...:|    |||...||  |....|......| |:.|: |:|....|.|..:...:.
  Fly   362 EKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEM-ERPGKKILRDDDLNEVSK 425

  Fly   397 AE------RVNNGSRN 406
            .|      |..:||||
  Fly   426 NEVVQKDTRSEDGSRN 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 53..138 CDD:472250 29/96 (30%)
Ig strand B 71..75 CDD:409371 1/3 (33%)
Ig strand E 120..124 CDD:409371 3/3 (100%)
Ig_3 214..287 CDD:464046 16/74 (22%)
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 34/113 (30%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 3/3 (100%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 24/148 (16%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 2/7 (29%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 19/77 (25%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 0/4 (0%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.