Sequence 1: | NP_729591.1 | Gene: | dpr10 / 39180 | FlyBaseID: | FBgn0052057 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006510497.1 | Gene: | Opcml / 330908 | MGIID: | 97397 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 257 | Identity: | 59/257 - (22%) |
---|---|---|---|
Similarity: | 87/257 - (33%) | Gaps: | 86/257 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 DLTMPR---NITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRF------QT 111
Fly 112 SYHRDIDEWTLQIKWAQQRDAGVYECQIST--QPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAF 174
Fly 175 YIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWY 239
Fly 240 HQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN----TEIASIRVHV 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr10 | NP_729591.1 | Ig | 63..143 | CDD:299845 | 22/87 (25%) |
IG_like | 210..297 | CDD:214653 | 24/90 (27%) | ||
IGc2 | 217..287 | CDD:197706 | 21/69 (30%) | ||
Opcml | XP_006510497.1 | Ig | 44..132 | CDD:416386 | 28/144 (19%) |
Ig strand A' | 44..49 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 51..59 | CDD:409353 | 4/7 (57%) | ||
CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 64..70 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 64..70 | CDD:409353 | 3/6 (50%) | ||
CDR2 | 71..83 | CDD:409353 | 3/13 (23%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/5 (20%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 9/40 (23%) | ||
Ig strand D | 87..94 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 97..103 | CDD:409353 | 1/12 (8%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 5/55 (9%) | ||
FR4 | 125..132 | CDD:409353 | 4/53 (8%) | ||
Ig_3 | 135..206 | CDD:404760 | 24/84 (29%) | ||
Ig strand A | 135..138 | CDD:409353 | 1/2 (50%) | ||
Ig strand A' | 144..148 | CDD:409353 | 1/3 (33%) | ||
Ig strand B | 151..160 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 165..170 | CDD:409353 | 1/6 (17%) | ||
Ig strand C' | 171..174 | CDD:409353 | 2/6 (33%) | ||
Ig strand F | 198..206 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 223..300 | CDD:404760 | |||
putative Ig strand A | 224..230 | CDD:409353 | |||
Ig strand B | 240..244 | CDD:409353 | |||
Ig strand C | 253..257 | CDD:409353 | |||
Ig strand E | 279..283 | CDD:409353 | |||
Ig strand F | 293..298 | CDD:409353 | |||
Ig strand G | 306..309 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |