DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr18

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:313 Identity:93/313 - (29%)
Similarity:130/313 - (41%) Gaps:38/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SVSNNNHNNAE--AKPTHAPPSHYPHGHKW----NEPYFDLTMPRNITSLVG--KSAYLGCRVKH 79
            |....||..|.  |:.|..|.|.:.|.|.|    .||....|...|:.|.|.  ..|.|.|||..
  Fly   186 STRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGM 250

  Fly    80 LGNKTVAWIRH--RDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQ 142
            |.:|||.|:|.  ..:.:||||..||:.|.|.:..:... :.|.|.|...|..|||||.||:||.
  Fly   251 LKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYP-NNWRLLINPTQTEDAGVYMCQVSTH 314

  Fly   143 PVRSYSVNLNIVD----LIDAETSDIMQQYYNDD-----------AFYIAENRVYQSSNDEFAGM 192
            |.|.::.||.:::    :||....|:..:||...           :|:..|.:....|.|.....
  Fly   315 PPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDA 379

  Fly   193 FGPIQTVAVPTATILGGPDLYVDKGSTINL-TCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKF 256
            ...:.........::|..:....|.|..:| ....||       |.|...::.|...|: .||  
  Fly   380 VQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKF-------ITWAKDEEPLQGMTN-RRL-- 434

  Fly   257 KTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTN 309
             ::......|.:.|.||.|..||.|||.........::|.||.||.|.|:|.|
  Fly   435 -SVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 34/83 (41%)
IG_like 210..297 CDD:214653 22/87 (25%)
IGc2 217..287 CDD:197706 20/70 (29%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 36/83 (43%)
Ig <258..326 CDD:299845 27/68 (40%)
IGc2 <417..461 CDD:197706 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.