DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Negr1

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:350 Identity:68/350 - (19%)
Similarity:108/350 - (30%) Gaps:150/350 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQR--FQTSYHRDIDEWTLQIKWAQQR 130
            |.:|.|.|.::. |....||:....  |:..|...::.|.|  ..|...||   ::|||:.....
Mouse    47 GDTAVLRCYLED-GASKGAWLNRSS--IIFAGGDKWSVDPRVSISTLNKRD---YSLQIQNVDVT 105

  Fly   131 DAGVYECQISTQPV-RSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFG 194
            |.|.|.|.:.||.. |:..|:|.:.                      ...::|..||        
Mouse   106 DDGPYTCSVQTQHTPRTMQVHLTVQ----------------------VPPKIYDISN-------- 140

  Fly   195 PIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYH------------------- 240
                            |:.:::|:.:.|||:....|||.  |.|.|                   
Mouse   141 ----------------DMTINEGTNVTLTCLATGKPEPV--ISWRHISPSAKPFENGQYLDIYGI 187

  Fly   241 -QDK----------------------------VLSEETSG----GRL-------------KFKTI 259
             :|:                            .:.|..||    ||.             .|:..
Mouse   188 TRDQAGEYECSAENDVSFPDVKKVRVIVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWY 252

  Fly   260 KSEE---------------TKSILLIYDADLLHSGKYSCYPSN---TEIASIRVHVLQGERPEAM 306
            |.|:               |:|||.:.:....|.|.|:|..:|   |..||:.::.:......:.
Mouse   253 KGEKRLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNQIIEPTTSSP 317

  Fly   307 QTNAAP----------AAVALACWS 321
            .|:.||          |....:|||
Mouse   318 VTSPAPSTAQYGITGSACDLFSCWS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 22/76 (29%)
IG_like 210..297 CDD:214653 32/169 (19%)
IGc2 217..287 CDD:197706 27/149 (18%)
Negr1XP_036019026.1 FR1 38..55 CDD:409353 3/7 (43%)
Ig strand A' 40..46 CDD:409353
IG_like 41..129 CDD:214653 26/87 (30%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 2/6 (33%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 2/11 (18%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 12/37 (32%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 3/8 (38%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 2/3 (67%)
Ig strand G 120..129 CDD:409353 3/8 (38%)
FR4 122..129 CDD:409353 2/6 (33%)
Ig strand A' 139..144 CDD:409353 3/28 (11%)
IGc2 146..204 CDD:197706 11/59 (19%)
Ig strand B 150..157 CDD:409353 3/6 (50%)
Ig strand C 163..168 CDD:409353 2/6 (33%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 0/5 (0%)
Ig strand F 193..200 CDD:409353 0/6 (0%)
Ig_3 219..295 CDD:404760 16/75 (21%)
putative Ig strand A 219..225 CDD:409353 1/5 (20%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 3/3 (100%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.