DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Dscaml1

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001101611.1 Gene:Dscaml1 / 315615 RGDID:1304887 Length:2111 Species:Rattus norvegicus


Alignment Length:278 Identity:62/278 - (22%)
Similarity:104/278 - (37%) Gaps:89/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLAVCYQRQSVSNNNHNNAEAK-PTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRV 77
            |:..|..|.||.:..:   :|: ....|||              :...||||::.|:...:.|||
  Rat   539 GVYRCTARNSVGSAEY---QARINVRGPPS--------------IRAMRNITAVAGRDTLINCRV 586

  Fly    78 KHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI--DEWTLQIKWAQQ-RDAGVYECQI 139
            ......::.|  ::|..:|              ...||.:  :..||::...|: .|.|.|.|.:
  Rat   587 IGYPYYSIKW--YKDALLL--------------PDNHRQVVFENGTLKLTDVQKGMDEGEYLCSV 635

  Fly   140 STQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTA 204
            ..||..|.|.::::.    .:...::|.:                   ||            |.|
  Rat   636 LIQPQLSISQSVHVA----VKVPPLIQPF-------------------EF------------PPA 665

  Fly   205 TILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILL 269
            :|          |..:.:.|::. |.:.|..|.|....:|:   .||..:   ||:|:|..|.|.
  Rat   666 SI----------GQLLYIPCVVS-SGDMPIRITWRKDGQVI---ISGSGV---TIESKEFMSSLQ 713

  Fly   270 IYDADLLHSGKYSCYPSN 287
            |....|.|:|.|:|..||
  Rat   714 ISSVSLKHNGNYTCIASN 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 18/82 (22%)
IG_like 210..297 CDD:214653 23/78 (29%)
IGc2 217..287 CDD:197706 21/69 (30%)
Dscaml1NP_001101611.1 IG 101..173 CDD:214652
IGc2 101..168 CDD:197706
Ig 183..276 CDD:299845
IG_like 195..276 CDD:214653
I-set 291..369 CDD:254352
IGc2 298..359 CDD:197706
IGc2 386..447 CDD:197706
I-set 466..560 CDD:254352 6/23 (26%)
Ig 466..556 CDD:299845 5/19 (26%)
IGc2 577..635 CDD:197706 16/73 (22%)
IG_like 665..744 CDD:214653 25/84 (30%)
Ig 673..739 CDD:143165 22/66 (33%)
I-set 748..843 CDD:254352
Ig7_DSCAM 765..843 CDD:143211
I-set 849..942 CDD:254352
Ig 861..949 CDD:299845
FN3 945..1039 CDD:238020
FN3 1046..1143 CDD:238020
fn3 1151..1237 CDD:278470
FN3 1249..1340 CDD:238020
IGc2 1364..1428 CDD:197706
FN3 1442..1532 CDD:238020
FN3 1546..1618 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.