DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Jaml

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_038938277.1 Gene:Jaml / 315610 RGDID:1562572 Length:379 Species:Rattus norvegicus


Alignment Length:408 Identity:81/408 - (19%)
Similarity:140/408 - (34%) Gaps:117/408 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YPHGHKWNEPYFDLTMPRNITSL-----VGKSAYLGCRVKHLGNK---TVAWIRHRDLHI----- 95
            ||.|..      |||    ::||     ||:||.:||.|:....|   .|.|:..:..|.     
  Rat    19 YPQGLP------DLT----VSSLKLRVHVGESALMGCVVQSTEEKPVDKVDWVFSKGEHAENEYV 73

  Fly    96 ------LTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIV 154
                  |:|.|..:....|......|  ::.:|.::..|:.|.|:|.|:|..:...|.|....::
  Rat    74 LYYYSSLSVPTGRFQNRSRLVGDLLR--NDGSLLLQDVQKADEGIYTCEIRLKNEGSVSKKFVLL 136

  Fly   155 DLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGST 219
            .::..|..                                                :|.|..|..
  Rat   137 HVLPEEPK------------------------------------------------ELRVHVGDP 153

  Fly   220 INLTCIIKFSPE-PPTHIFWY-------HQDKVLSEE------TSGGRLKFKTIK------SEET 264
            |.:.|..:.:.| ..|.:.|.       .::.|||.:      |..|:.:|:...      |...
  Rat   154 IQMGCFFRSTEERRVTRVNWMFSSGKHAQEEIVLSYDFNMHSGTFQGQGRFRNRVDLTGDISRND 218

  Fly   265 KSILL--IYDADLLHSGKYSC--YPSNTEI-ASIRVHVLQGERPEAMQTNAAPAAVALACWSCHF 324
            .||:|  :..:|   .|.|:|  |....|. .:|.:||:|.|.|.::.|....|.......    
  Rat   219 GSIMLQTVKKSD---QGVYTCSIYLGKLESRKTIVLHVIQDESPRSISTTTETAGKQQGIL---- 276

  Fly   325 GQATQAVRVISTMVAALVLLEACSSLLLQSGGGGGCPGGGSPAGGMPTRVREIREKPLTNSLLDP 389
             ...|.|.::..:.|.|:||.....::.::..........:....:..:.:...||.:.:|    
  Rat   277 -DGNQLVIIVGIVCATLLLLPVLILIVKKTKWNKSSVSSIASVKSLENKEKTSSEKHVYSS---- 336

  Fly   390 KIPSTTSAERVNNGSRNA 407
             |.:..:|||..:|...|
  Rat   337 -ITTWETAERGPSGESEA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 25/98 (26%)
IG_like 210..297 CDD:214653 25/111 (23%)
IGc2 217..287 CDD:197706 21/93 (23%)
JamlXP_038938277.1 V-set 33..139 CDD:400157 25/107 (23%)
FR2 58..69 CDD:409353 3/10 (30%)
CDR2 70..82 CDD:409353 1/11 (9%)
Ig strand C' 71..77 CDD:409353 0/5 (0%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
FR3 87..121 CDD:409353 8/35 (23%)
Ig strand D 90..96 CDD:409353 1/5 (20%)
Ig strand E 100..108 CDD:409353 1/7 (14%)
Ig strand F 115..122 CDD:409353 3/6 (50%)
V-set 141..253 CDD:400157 26/162 (16%)
Ig strand A' 144..150 CDD:409353 2/53 (4%)
Ig strand B 152..162 CDD:409353 2/9 (22%)
CDR1 162..169 CDD:409353 1/6 (17%)
Ig strand C 169..176 CDD:409353 2/6 (33%)
FR2 170..181 CDD:409353 1/10 (10%)
CDR2 182..196 CDD:409353 3/13 (23%)
Ig strand C' 183..189 CDD:409353 2/5 (40%)
Ig strand C' 191..196 CDD:409353 0/4 (0%)
FR3 204..238 CDD:409353 9/36 (25%)
Ig strand D 207..213 CDD:409353 0/5 (0%)
Ig strand E 217..225 CDD:409353 3/7 (43%)
Ig strand F 232..238 CDD:409353 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.