DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Kirrel3

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus


Alignment Length:399 Identity:91/399 - (22%)
Similarity:145/399 - (36%) Gaps:116/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTGLAVCYQRQSVSNNN----HNNAEAKPTHAPPSHYPHGHKWNE------------PYFDLTMP 60
            |..|:|  :.|.|..:|    |.:|:|.|..........||...|            .||...:.
  Rat   251 LVNLSV--EPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVS 313

  Fly    61 RNITSLVGKS-------AYLGCRVK--------HLGNKTV---AWIRHRDLHILTV--GTYTYTT 105
            ..:|:.:|.:       .|.|.|:.        .||:..|   |||.:..|.|:.:  |:....:
  Rat   314 CEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLS 378

  Fly   106 DQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYN 170
            :::            ||.:|..:|.|||.|.|:.             :|..:.|           
  Rat   379 NEK------------TLTLKSVRQEDAGKYVCRA-------------VVPRVGA----------- 407

  Fly   171 DDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH 235
                  .|..|..:.|       ||....:..|...|.|     :||   .:.|.|:.:| ||..
  Rat   408 ------GEREVTLTVN-------GPPIISSTQTQHALHG-----EKG---QIKCFIRSTP-PPDR 450

  Fly   236 IFWYHQDKVLSEETSGGRLKFKTIKSEE----TKSILLIYDADLLHSGKYSC-----YPSNTEIA 291
            |.|..::.||...|| ||...:|:.:||    |.:|..|..||.  ...|:|     :.|:|||.
  Rat   451 IAWSWKENVLESGTS-GRYTVETVNTEEGVISTLTISNIVRADF--QTIYNCTAWNSFGSDTEII 512

  Fly   292 SIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGG 356
            .::....:.:....::..:.|.||.:       |.|..|......::|.:|.. .|:.....:||
  Rat   513 RLKEQGSEMKSGAGLEAESVPMAVII-------GVAVGAGVAFLVLMATIVAF-CCARSQRSTGG 569

  Fly   357 GGGCPGGGS 365
            ..|..|.|:
  Rat   570 RPGISGRGT 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/99 (23%)
IG_like 210..297 CDD:214653 29/95 (31%)
IGc2 217..287 CDD:197706 24/78 (31%)
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416
Ig strand E 210..214 CDD:409416
Ig strand F 224..229 CDD:409416
Ig strand G 239..242 CDD:409416
Ig <267..334 CDD:416386 12/66 (18%)
Ig strand B 267..274 CDD:409353 1/6 (17%)
Ig strand C 279..286 CDD:409353 0/6 (0%)
Ig strand C' 288..291 CDD:409353 2/2 (100%)
Ig strand D 298..302 CDD:409353 0/3 (0%)
Ig strand E 304..310 CDD:409353 2/5 (40%)
Ig strand G 321..334 CDD:409353 2/12 (17%)
Ig 335..416 CDD:416386 23/122 (19%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 3/9 (33%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 2/17 (12%)
IgI_5_KIRREL3 418..515 CDD:409479 34/108 (31%)
Ig strand B 436..440 CDD:409479 1/6 (17%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.