DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Igsf9b

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:287 Identity:67/287 - (23%)
Similarity:94/287 - (32%) Gaps:92/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVK-HLGNKTVAWIRHRDLHILTVGTYTYTTDQR--FQTSYH 114
            |.|.::.|.|||..:.:.|.|.||.: :.||.|..|               |..|:.  ||....
  Rat   228 PPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTW---------------YWQDENVYFQNDLK 277

  Fly   115 ---RDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYI 176
               |.:.:.||.|...:..|||.|.|..|....||.|.:..:                       
  Rat   278 LRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYL----------------------- 319

  Fly   177 AENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQ 241
                                 ||..|...:...|.:||..|....:.|.:...| |.|.:.|...
  Rat   320 ---------------------TVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEP-PATVVKWNKD 362

  Fly   242 DKVLSEETSGG--RLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNT-----EIASIRV---- 295
            .:.|..|.:.|  .::..:|:.||.....|         |.|:|.|.||     :.|..|:    
  Rat   363 GRPLQVEKNLGWTLMEDGSIRIEEATEEAL---------GTYTCVPYNTLGTMGQSAPARLVLKD 418

  Fly   296 ----HVLQG--ERPEAMQTNAAPAAVA 316
                .||.|  .|.||.:....|.|.|
  Rat   419 PPYFTVLPGWEYRQEAGRELLIPCAAA 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 24/85 (28%)
IG_like 210..297 CDD:214653 24/101 (24%)
IGc2 217..287 CDD:197706 17/71 (24%)
Igsf9bNP_001363879.1 PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Ig 41..115 CDD:319273
I-set 139..225 CDD:369462
Ig 229..321 CDD:386229 30/150 (20%)
Ig <353..414 CDD:386229 17/69 (25%)
Ig 438..502 CDD:319273 3/8 (38%)
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.