DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Fas2

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:294 Identity:56/294 - (19%)
Similarity:100/294 - (34%) Gaps:102/294 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 THAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTY 101
            |:||.:.||                    .:|:...:.|.||...|.|:.|:|:        |..
  Fly   141 TNAPENQYP--------------------TLGQDYVVMCEVKADPNPTIDWLRN--------GDP 177

  Fly   102 TYTTDQRF--QTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDI 164
            ..||:.::  ||:        .|.|:..|:.|.|:|.|:.:.                 .||.::
  Fly   178 IRTTNDKYVVQTN--------GLLIRNVQESDEGIYTCRAAV-----------------IETGEL 217

  Fly   165 MQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFS 229
            :::....:.|...|                   .:::||       :|...:|......|..:..
  Fly   218 LERTIRVEVFIQPE-------------------IISLPT-------NLEAVEGKPFAANCTARGK 256

  Fly   230 PEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASI- 293
            |.|  .|.|......|:..|:.   :|:........:|..:...|.   |.|:|...|.  |.: 
  Fly   257 PVP--EISWIRDATQLNVATAD---RFQVNPQTGLVTISSVSQDDY---GTYTCLAKNR--AGVV 311

  Fly   294 ----RVHVLQGERPEAMQ----TNAAPAAVALAC 319
                :::||  .||:..:    |.|....:|:.|
  Fly   312 DQKTKLNVL--VRPQIYELYNVTGARTKEIAITC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 20/81 (25%)
IG_like 210..297 CDD:214653 17/91 (19%)
IGc2 217..287 CDD:197706 14/69 (20%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 25/134 (19%)
IGc2 152..209 CDD:197706 20/72 (28%)
I-set 230..319 CDD:254352 20/124 (16%)
IGc2 243..309 CDD:197706 15/75 (20%)
IG_like 330..424 CDD:214653 4/14 (29%)
IGc2 339..412 CDD:197706 2/5 (40%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.