DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Kirrel1

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:280 Identity:63/280 - (22%)
Similarity:89/280 - (31%) Gaps:104/280 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PRNITSLVGKSAYLGCRVKH---------------LGNKTVAWIRHRDLHILTVGTYTYTTDQRF 109
            |.:.|.:.|..|.|.|.:.:               :|....||.|:|     .||:         
  Rat    59 PADQTVVAGHRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYR-----VVGS--------- 109

  Fly   110 QTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAF 174
                 .|..::.|:|..|:..|...||||.:...:||....|                       
  Rat   110 -----ADAGQYNLEITDAELSDDASYECQATEAALRSRRAKL----------------------- 146

  Fly   175 YIAENRVYQSSNDEFAGMFGPIQTVAVP--TATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIF 237
                                   ||.:|  ...|.|||.:.:..|:..|||| ..|:.:|...|.
  Rat   147 -----------------------TVLIPPEDTRIDGGPVILLQAGTPYNLTC-RAFNAKPAATII 187

  Fly   238 WYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIAS-------IRV 295
            |: :|....|.........|..|.|.|.|.|||...||.....::|...|..|.:       :.|
  Rat   188 WF-RDGTQQEGAVTSTELLKDGKRETTISQLLIQPTDLDIGRVFTCRSMNEAIPNGKETSIELDV 251

  Fly   296 H-------------VLQGER 302
            |             ||:|||
  Rat   252 HHPPTVTLSIEPQTVLEGER 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 21/94 (22%)
IG_like 210..297 CDD:214653 27/106 (25%)
IGc2 217..287 CDD:197706 22/69 (32%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 25/153 (16%)
Ig 57..148 CDD:299845 25/153 (16%)
Ig2_KIRREL3-like 170..251 CDD:143236 23/82 (28%)
I-set 255..336 CDD:254352 5/17 (29%)
Ig_2 259..337 CDD:290606 5/13 (38%)
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.