DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr9

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:384 Identity:130/384 - (33%)
Similarity:187/384 - (48%) Gaps:88/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTGL--AVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLG 74
            :||:  :..::..|.|:|..::..|...|............. ||||....:|:|:|:||:|||.
  Fly   214 ITGIPSSSLHKASSASSNTFSSQLASGFHRNSIDLEEARNAG-PYFDKAFSKNVTALLGKTAYLN 277

  Fly    75 CRVKHLGNKT----VAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVY 135
            ||||:|||||    |:|:||||:|:||||.||||:||||:..:....::|.||||:.|.||:|:|
  Fly   278 CRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIY 342

  Fly   136 ECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVA 200
            |||:||.|..|:.::||:|:                                             
  Fly   343 ECQVSTTPHMSHYIHLNVVE--------------------------------------------- 362

  Fly   201 VPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD------KVLSEETSGGRLKFKTI 259
             |:..|:|.||||::.||||||||||:.|||||.:|||.|.:      ::::.::..|.:...|.
  Fly   363 -PSTEIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTN 426

  Fly   260 KSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQ----TNAA--------- 311
            |.:.|.|.|||..|....||.|.|.|||.:..|:.||||.|......:    :|||         
  Fly   427 KGDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPL 491

  Fly   312 --------PAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGGGGGCPG 362
                    |..|.|...:|.:        :.:.:.|||.......|....:|...|.||
  Fly   492 AHSLSVCVPVCVLLQLGACRW--------IAALLGAALATPPPLRSTRRATGERPGSPG 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 50/83 (60%)
IG_like 210..297 CDD:214653 41/92 (45%)
IGc2 217..287 CDD:197706 33/75 (44%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 55/97 (57%)
IG_like 263..360 CDD:214653 54/96 (56%)
IG_like 371..464 CDD:214653 41/92 (45%)
IGc2 377..456 CDD:197706 35/78 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444674
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D413759at33208
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.