DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Jaml

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006510445.4 Gene:Jaml / 270152 MGIID:2685484 Length:405 Species:Mus musculus


Alignment Length:360 Identity:71/360 - (19%)
Similarity:119/360 - (33%) Gaps:136/360 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNK---TVAWIRHRDL-----HILT 97
            |..||.|    .|...::.|: :...||:|..:||.|:....|   .|.|:..:|.     ::|.
Mouse    42 PVGYPQG----LPGLTVSSPQ-LRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLF 101

  Fly    98 VGTYTYTTDQRFQT-------SYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVD 155
            ..:.......|||.       ::|.|   .:|.::..|:.|.|:|.|:|..:             
Mouse   102 YYSNLSVPTGRFQNRSHLVGDTFHND---GSLLLQDVQKADEGIYTCEIRLK------------- 150

  Fly   156 LIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTI 220
                ..|.:|::                           |::...:|...    .||.|..|.|.
Mouse   151 ----NESMVMKK---------------------------PVELWVLPEEP----KDLRVRVGDTT 180

  Fly   221 NLTCIIKFSPEP-PTHIFWY-------HQDKVLSEET---SG----------------------G 252
            .:.|.|:.:.|. .|.:.|.       .::.|||.::   ||                      |
Mouse   181 QMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDG 245

  Fly   253 RLKFKTIKSEETKSILLIYDADLLHSGKYSC--YPSNTEI-ASIRVHVLQGERPEAMQTNAAPAA 314
            .:|.:|:|..:              .|.|:|  |....|. .:|.:||:|.|    .|...:|..
Mouse   246 SIKLQTVKESD--------------QGIYTCSIYVGKLESRKTIVLHVVQDE----FQRTISPTP 292

  Fly   315 VALACWSCHFGQ-----ATQAVRVISTMVAALVLL 344
                  ....||     ..|.|.::..:.|..:||
Mouse   293 ------PTDKGQQGILNGNQLVIIVGIVCATFLLL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/94 (24%)
IG_like 210..297 CDD:214653 25/122 (20%)
IGc2 217..287 CDD:197706 20/104 (19%)
JamlXP_006510445.4 V-set 55..165 CDD:369466 27/157 (17%)
V-set 167..280 CDD:369466 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.