DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Lsamp

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:278 Identity:66/278 - (23%)
Similarity:95/278 - (34%) Gaps:97/278 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 WNEPYFD-----LTMP---------------------------RNITSLVGKSAYLGCRVKHLGN 82
            ||:|..:     :|:|                           .|||...|.:|.|.|.|:...:
Mouse    27 WNQPPAEVNLSPITIPGTEETMRKKAKEEEGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNS 91

  Fly    83 KTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSY 147
            | |||:....  |:..|...::.|.|.:.. .|...|::|:|:.....|.|.|.|.:.||.    
Mouse    92 K-VAWLNRSG--IIFAGHDKWSLDPRVELE-KRHALEYSLRIQKVDVYDEGSYTCSVQTQH---- 148

  Fly   148 SVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDL 212
                      :.:||.:          |:                     .|.||........|:
Mouse   149 ----------EPKTSQV----------YL---------------------IVQVPPKISNISSDV 172

  Fly   213 YVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLH 277
            .|::||.:.|.|:....|||.  |.|.|... |..|..|         .||...||.|...   .
Mouse   173 TVNEGSNVTLVCMANGRPEPV--ITWRHLTP-LGREFEG---------EEEYLEILGITRE---Q 222

  Fly   278 SGKYSCYPSNTEIASIRV 295
            ||||.|..:| |::|..|
Mouse   223 SGKYECKAAN-EVSSADV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 24/79 (30%)
IG_like 210..297 CDD:214653 29/86 (34%)
IGc2 217..287 CDD:197706 23/69 (33%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 29/138 (21%)
Ig_3 163..232 CDD:372822 25/83 (30%)
Ig_3 250..325 CDD:372822
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.