DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and NEGR1

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:369 Identity:76/369 - (20%)
Similarity:115/369 - (31%) Gaps:153/369 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSHYPHGHKWNEPY--FDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTY 103
            ||..|.|...:.|:  .|..|.|.     |.:|.|.|.::. |....||:....  |:..|...:
Human    29 PSCLPAGQSVDFPWAAVDNMMVRK-----GDTAVLRCYLED-GASKGAWLNRSS--IIFAGGDKW 85

  Fly   104 TTDQR--FQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPV-RSYSVNLNIVDLIDAETSDIM 165
            :.|.|  ..|...||   ::|||:.....|.|.|.|.:.||.. |:..|:|.:.           
Human    86 SVDPRVSISTLNKRD---YSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQ----------- 136

  Fly   166 QQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSP 230
                       ...::|..||                        |:.|::|:.:.|||:....|
Human   137 -----------VPPKIYDISN------------------------DMTVNEGTNVTLTCLATGKP 166

  Fly   231 EPPTHIFWYH--------------------QDK----------------------------VLSE 247
            ||  .|.|.|                    :|:                            .:.|
Human   167 EP--SISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQE 229

  Fly   248 ETSG----GRL-------------KFKTIKSEE---------------TKSILLIYDADLLHSGK 280
            ..||    ||.             .|:..|.|:               |:|||.:.:....|.|.
Human   230 IKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGN 294

  Fly   281 YSCYPSN---TEIASIRVHVLQGERPEAMQTNAAPAA-VALACW 320
            |:|..:|   |..||:.::     .|...|.....:| |..:||
Human   295 YTCVAANKLGTTNASLPLN-----PPSTAQYGITGSADVLFSCW 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 22/81 (27%)
IG_like 210..297 CDD:214653 33/169 (20%)
IGc2 217..287 CDD:197706 27/149 (18%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 28/98 (29%)
IGc2 152..210 CDD:197706 11/59 (19%)
Ig_3 225..301 CDD:372822 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.