DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Lrit3

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001274153.1 Gene:Lrit3 / 242235 MGIID:2685267 Length:681 Species:Mus musculus


Alignment Length:397 Identity:74/397 - (18%)
Similarity:125/397 - (31%) Gaps:127/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQIS 140
            |:..:.|:.|.::|:.        |....:..|..|.....:|.|:                .::
Mouse   140 RIASVPNEAVRYLRNL--------TCLDLSSNRLTTLPPDFLDSWS----------------HLA 180

  Fly   141 TQPVRS-----YSVNLNIVD---LIDAETSDIMQ-QYYNDDAFYIAENRVYQSSNDEFAGMFGPI 196
            ..|.||     ..:.|.:.|   ..|...|.::: ....|.|..:.:..:..|..:.|.|:.  .
Mouse   181 VTPSRSPDFPPRRIILGLQDNPWFCDCHISKVIELSKVTDHAVVLLDPLMVCSEPERFQGIL--F 243

  Fly   197 QTV----AVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD-----KVLSEETSGG 252
            |.|    .:..:.::....:....||.:.|.|..|..|.|  .:.|...|     ..:.:|:.|.
Mouse   244 QRVELEKCLKPSVMMSATKITSALGSNVLLRCDAKGHPTP--QLTWTRSDGSTVNYTVIQESPGE 306

  Fly   253 RLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVL------------------- 298
            .:::..|      |:..|...|   :|.|.|...|  :|.|...|:                   
Mouse   307 GIRWSII------SLTSISHKD---AGDYRCKAKN--LAGISEAVVTVTVVGGVTTTLSPDSSER 360

  Fly   299 -QGERPE------------------AMQTNAAP------AAVALACWS------CHFGQATQAVR 332
             .||.||                  :....:||      ||:..:.||      .....|..|..
Mouse   361 SPGEPPEQHPQPGLGGSTPPSKSWLSPGLTSAPSYPTPSAALYTSTWSPPPSSLPPIFSAASATT 425

  Fly   333 VISTMVAALVLLEACSSLLLQSGGGGGCPGGGSPAGGMPTRVREIREK--PLTNS------LLDP 389
            .:.|.::......:....||.       |||.|.|     ::.:...|  ||:.|      |||.
Mouse   426 SVQTSISGRTARTSHQPPLLH-------PGGKSNA-----KIEKNGRKFPPLSASKKEELALLDQ 478

  Fly   390 KIPSTTS 396
            ..|..|:
Mouse   479 AAPMETN 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 9/66 (14%)
IG_like 210..297 CDD:214653 21/91 (23%)
IGc2 217..287 CDD:197706 18/74 (24%)
Lrit3NP_001274153.1 LRR 1. /evidence=ECO:0000255 56..79
LRR_8 61..117 CDD:290566
LRR 2. /evidence=ECO:0000255 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3. /evidence=ECO:0000255 104..128
LRR_8 105..165 CDD:290566 5/32 (16%)
LRR_4 106..146 CDD:289563 1/5 (20%)
leucine-rich repeat 107..130 CDD:275378
LRR_4 129..170 CDD:289563 7/37 (19%)
LRR 4. /evidence=ECO:0000255 129..151 3/10 (30%)
leucine-rich repeat 131..154 CDD:275378 3/13 (23%)
LRR 5. /evidence=ECO:0000255 152..175 4/30 (13%)
leucine-rich repeat 155..168 CDD:275378 2/20 (10%)
Ig 254..335 CDD:299845 19/93 (20%)
IG_like 263..339 CDD:214653 21/88 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..391 4/40 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..464 9/50 (18%)
FN3 489..563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.