DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Ptprq

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001357916.1 Gene:Ptprq / 237523 MGIID:1096349 Length:2301 Species:Mus musculus


Alignment Length:290 Identity:60/290 - (20%)
Similarity:97/290 - (33%) Gaps:88/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTL 122
            |:|..:.|:...:|:...:...:   |:.||: .|..:.....|..||..|.|     ...||..
Mouse  1426 TLPETVPSVPTNTAFSNVQSTSV---TLRWIK-PDTILGYFQNYKITTQLRAQ-----KCREWEP 1481

  Fly   123 QIKWAQQRDAGVYECQISTQPVR-SYSVNLNIVDLIDAETSDIMQ-----QYYNDDAFYIAENRV 181
            :            || :..|.|: .|..|         :|.|.::     |:|.   |.:|    
Mouse  1482 E------------EC-VEHQEVQYLYEAN---------QTEDTVRGLKKFQWYR---FQVA---- 1517

  Fly   182 YQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSP--------EP-----P 233
             .|:|..:......|.|..:|     |.||     |...|:. ::..||        ||     |
Mouse  1518 -ASTNAGYGNASSWISTQTLP-----GPPD-----GPPENVR-VVATSPFGINISWNEPAIITGP 1570

  Fly   234 THIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLH-------------SGKYSCYP 285
            |    ::...|.|.:.....:.|  :||.|......|.|.::..             ||.|:...
Mouse  1571 T----FYLIDVKSVDNDNFNISF--VKSNEENKTTEINDLEVFTRYSVVITAFVGNVSGAYTDGK 1629

  Fly   286 SNTEIASIRVHVLQGERPEAMQTNAAPAAV 315
            |:.|:....:..:..:.|..|.....|..|
Mouse  1630 SSAEVIITTLESVPKDPPNNMTFQKIPDEV 1659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 15/79 (19%)
IG_like 210..297 CDD:214653 23/112 (21%)
IGc2 217..287 CDD:197706 19/95 (20%)
PtprqNP_001357916.1 FN3 57..151 CDD:238020
FN3 308..393 CDD:238020
fn3 399..>441 CDD:365830
FN3 570..654 CDD:238020
fn3 668..744 CDD:365830
FN3 762..850 CDD:238020
fn3 857..934 CDD:365830
FN3 951..1049 CDD:238020
FN3 1056..1137 CDD:238020
FN3 1152..1233 CDD:238020
FN3 1247..1337 CDD:238020
FN3 1342..1421 CDD:238020
FN3 1432..1535 CDD:238020 29/141 (21%)
FN3 1542..1638 CDD:238020 21/102 (21%)
FN3 1645..1734 CDD:238020 4/15 (27%)
UP_III_II 1759..1928 CDD:297589
R-PTPc-Q 2033..2256 CDD:350464
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.