DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Igsf9b

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:287 Identity:67/287 - (23%)
Similarity:94/287 - (32%) Gaps:92/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVK-HLGNKTVAWIRHRDLHILTVGTYTYTTDQR--FQTSYH 114
            |.|.::.|.|||..:.:.|.|.||.: :.||.|..|               |..|:.  ||....
Mouse   230 PPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTW---------------YWQDENVYFQNDLK 279

  Fly   115 ---RDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYI 176
               |.:.:.||.|...:..|||.|.|..|....||.|.:..:                       
Mouse   280 LRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYL----------------------- 321

  Fly   177 AENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQ 241
                                 ||..|...:...|.:||..|....:.|.:...| |.|.:.|...
Mouse   322 ---------------------TVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEP-PATVVKWNKD 364

  Fly   242 DKVLSEETSGG--RLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNT-----EIASIRV---- 295
            .:.|..|.:.|  .::..:|:.||.....|         |.|:|.|.||     :.|..|:    
Mouse   365 GRPLQVEKNLGWTLMEDGSIRIEEATEEAL---------GTYTCVPYNTLGTMGQSAPARLVLKD 420

  Fly   296 ----HVLQG--ERPEAMQTNAAPAAVA 316
                .||.|  .|.||.:....|.|.|
Mouse   421 PPYFTVLPGWEYRQEAGRELLIPCAAA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 24/85 (28%)
IG_like 210..297 CDD:214653 24/101 (24%)
IGc2 217..287 CDD:197706 17/71 (24%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462
Ig 231..323 CDD:386229 30/150 (20%)
Ig <355..416 CDD:386229 17/69 (25%)
Ig 440..504 CDD:319273 3/8 (38%)
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.