DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and IGSF9B

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:287 Identity:66/287 - (22%)
Similarity:94/287 - (32%) Gaps:92/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVK-HLGNKTVAWIRHRDLHILTVGTYTYTTDQR--FQTSYH 114
            |.|.::.|.|||..:.:.|.|.||.: :.||.|..|               |..|:.  ||....
Human   228 PPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTW---------------YWQDENVYFQNDLK 277

  Fly   115 ---RDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYI 176
               |.:.:.||.|...:..|:|.|.|..|....||.|.:..:                       
Human   278 LRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGRSPSASAYL----------------------- 319

  Fly   177 AENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQ 241
                                 ||..|...:...|.:||..|....:.|.:...| |.|.:.|...
Human   320 ---------------------TVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEP-PATVVKWNKD 362

  Fly   242 DKVLSEETSGG--RLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNT-----EIASIRV---- 295
            .:.|..|.:.|  .::..:|:.||.....|         |.|:|.|.||     :.|..|:    
Human   363 GRPLQVEKNLGWTLMEDGSIRIEEATEEAL---------GTYTCVPYNTLGTMGQSAPARLVLKD 418

  Fly   296 ----HVLQG--ERPEAMQTNAAPAAVA 316
                .||.|  .|.||.:....|.|.|
Human   419 PPYFTVLPGWEYRQEAGRELLIPCAAA 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/85 (27%)
IG_like 210..297 CDD:214653 24/101 (24%)
IGc2 217..287 CDD:197706 17/71 (24%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653
Ig 41..115 CDD:143165
I-set 139..225 CDD:254352
IGc2 153..210 CDD:197706
I-set 229..321 CDD:254352 29/150 (19%)
Ig 235..321 CDD:299845 28/144 (19%)
IG_like 331..414 CDD:214653 23/92 (25%)
Ig <353..414 CDD:299845 17/69 (25%)
IG_like 426..505 CDD:214653 7/20 (35%)
Ig 442..505 CDD:299845 2/4 (50%)
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.