DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and zig-2

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:160 Identity:38/160 - (23%)
Similarity:56/160 - (35%) Gaps:60/160 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 DLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSIL--LIYD- 272
            |..|..|....|:|....:|.|  .|:|         |.:|.|     |:.|||.::.  ::.| 
 Worm    41 DSNVTFGEKFVLSCGANGAPLP--SIYW---------ELNGMR-----IQGEETSNVYENILNDG 89

  Fly   273 -----------------ADLLHSGKYSCYPSN--TEIASIRVHVLQGERPE-AMQTNAAP----- 312
                             |...:||.|.|...|  |::..:....:.|.:.. |:..|.||     
 Worm    90 KQVSNAAMVSSHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMT 154

  Fly   313 ---------AAVALAC-------WSCHFGQ 326
                     .||||:|       ||.|.|:
 Worm   155 VDFRLEISNNAVALSCRSETATEWSWHKGE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845
IG_like 210..297 CDD:214653 24/107 (22%)
IGc2 217..287 CDD:197706 20/89 (22%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 24/108 (22%)
Ig 34..121 CDD:299845 22/95 (23%)
Ig <179..232 CDD:299845 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.