DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and rig-3

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:275 Identity:40/275 - (14%)
Similarity:73/275 - (26%) Gaps:115/275 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GHKWNEPYFDLT------MPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTT 105
            |....||...:|      :...|.::.|..|.:....|.....||:.|        |:..:..|:
 Worm   171 GPSGKEPMIQMTNGNGEPLDEEIWTIAGNEATIDSLKKEHAELTVSCI--------TIEMHQETS 227

  Fly   106 DQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYN 170
            .:.|.....:|                                ||:.:..|.:.||.:.:|    
 Worm   228 KEEFPVVDRKD--------------------------------VNIEVYTLPEFETEESVQ---- 256

  Fly   171 DDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH 235
               :.:.:|.|..:.                                    :.|.:..|..|..|
 Worm   257 ---YTVIDNHVRDAI------------------------------------IYCNVTHSFPPVRH 282

  Fly   236 IFWYHQDKVLSEE-----------TSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTE 289
            ..:||.|:.:...           :.|..||...:...:.              |.|.|..:|.:
 Worm   283 YTFYHGDEEIKMSDKFNIFVNVGVSQGAHLKIHNVNENDL--------------GTYKCEANNIK 333

  Fly   290 IASIR-VHVLQGERP 303
            ..|.. :|:.:...|
 Worm   334 AKSYHTIHLREANAP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 11/79 (14%)
IG_like 210..297 CDD:214653 15/98 (15%)
IGc2 217..287 CDD:197706 13/80 (16%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653
Ig 267..341 CDD:319273 15/123 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.