DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Ncam1

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:451 Identity:86/451 - (19%)
Similarity:148/451 - (32%) Gaps:165/451 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRF---QTSYHRDIDEWTLQIKWAQQ 129
            |:.|.:.|.|......|:.| :|:...::      ...|.||   ..:|        |||:..::
Mouse   132 GEDAVIVCDVVSSLPPTIIW-KHKGRDVI------LKKDVRFIVLSNNY--------LQIRGIKK 181

  Fly   130 RDAGVYECQ------------------------ISTQPVRSYSVNL--NIVDLIDAE-------- 160
            .|.|.|.|:                        .:.|.:.:.:.||  ::..:.||:        
Mouse   182 TDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMS 246

  Fly   161 -TSD------------------------IMQQYYNDDAFY--IAENRVYQSSNDEFAGMFGPIQT 198
             |.|                        |.....||:|.|  ||||:    :.::.|.:.  ::.
Mouse   247 WTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENK----AGEQDASIH--LKV 305

  Fly   199 VAVPTATILGGPDLYVDKGST------INLTCIIKFSPEPPTHIFWYHQDKVLS----------- 246
            .|.|..|       ||:..:.      :.|||  :.|.:|...|.|....:.:|           
Mouse   306 FAKPKIT-------YVENQTAMELEEQVTLTC--EASGDPIPSITWRTSTRNISSEEKASWTRPE 361

  Fly   247 -EETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNA 310
             :||..|.:   .::|....|.|.:.......:|:|.|..|||        :.|..:...::...
Mouse   362 KQETLDGHM---VVRSHARVSSLTLKSIQYTDAGEYICTASNT--------IGQDSQSMYLEVQY 415

  Fly   311 AP---AAVALACW-------SCH---FGQAT---------------QAVRVISTMVAALVLLEAC 347
            ||   ..||:..|       :|.   :..||               ..:::.:|..|:.:.:...
Mouse   416 APKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPD 480

  Fly   348 SSLLLQSGGGGGCPGGGSPAGGMPTRVREIREKPLTNSLLDPKIPSTTSAERVNNGSRNAR 408
            |.   ...|...|           |.|..|.::.|...|:....||:.|.:||...|..|:
Mouse   481 SE---NDFGNYNC-----------TAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQ 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 18/101 (18%)
IG_like 210..297 CDD:214653 22/104 (21%)
IGc2 217..287 CDD:197706 17/87 (20%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 17/72 (24%)
Ig3_NCAM-1_like 211..308 CDD:143207 17/102 (17%)
Ig_NCAM-1 307..413 CDD:143277 26/125 (21%)
Ig_3 417..494 CDD:372822 13/90 (14%)
FN3 509..606 CDD:238020 7/19 (37%)
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.