DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and rig-4

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_501339.2 Gene:rig-4 / 177597 WormBaseID:WBGene00004371 Length:2325 Species:Caenorhabditis elegans


Alignment Length:252 Identity:52/252 - (20%)
Similarity:97/252 - (38%) Gaps:50/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 MPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQ 123
            :|..|...||.|..|.|.||...:..:.|.::.          ...|.||.:           |.
 Worm   329 LPNEIQKTVGSSLSLKCSVKKKSSMDIKWYKNG----------LMMTTQRGK-----------LT 372

  Fly   124 IKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQS---- 184
            |...:|.|.|:|:|:.:    .:...:|..|.:.:.|.::.:....::|...:.|....::    
 Worm   373 IDRIKQDDFGLYQCEAT----NAAGADLASVWVKEGEANETVATEMSEDGMSLEEEISMETPPPR 433

  Fly   185 -----SNDEFAGMFGPIQTVAVPTATILGGP-DLYVDKGS-TINLTCIIKFSPEPPTHIFWYHQD 242
                 .|.:......|..:...|:..::..| ||.|..|: .|.:.|....|  ||.:|.|.   
 Worm   434 KLKFFDNSKSQEQLFPFTSELEPSQKLIKTPKDLTVASGTDRIMMECAATGS--PPPNIIWL--- 493

  Fly   243 KVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEI---ASIRVH 296
                  .:|..::...:|.:.|...|.|:|......|:|:|..|.:.:   |:::|:
 Worm   494 ------LNGHEIQTDNVKYDLTNDGLAIHDIRKSDEGEYTCEISGSNVKATANVQVN 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 19/79 (24%)
IG_like 210..297 CDD:214653 24/92 (26%)
IGc2 217..287 CDD:197706 17/70 (24%)
rig-4NP_501339.2 IG_like 330..402 CDD:214653 22/96 (23%)
IGc2 338..393 CDD:197706 17/79 (22%)
I-set 459..543 CDD:254352 23/94 (24%)
IGc2 478..534 CDD:197706 16/66 (24%)
IG_like 553..639 CDD:214653
Ig 564..635 CDD:143165
FN3 643..747 CDD:238020
FN3 756..850 CDD:238020
FN3 858..954 CDD:238020
FN3 959..1042 CDD:238020
FN3 1057..1151 CDD:238020
FN3 1156..1251 CDD:238020
FN3 1258..1356 CDD:238020
FN3 1361..1453 CDD:238020
FN3 1464..1560 CDD:238020
FN3 1572..1664 CDD:238020
FN3 1679..1764 CDD:238020
FN3 1774..1858 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.