DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and rig-5

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:289 Identity:58/289 - (20%)
Similarity:101/289 - (34%) Gaps:90/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFCCLTGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAY 72
            ||..|.|:.:.: :|:.|..      |.||...||                 ..:..:|:|:...
 Worm    63 LFALLCGVLLVF-KQACSRG------APPTIQQPS-----------------MSSAVALLGQDVD 103

  Fly    73 LGCRVKHLGNKTVAWIR-HRDLHILTVGTYTYTTDQRFQT-----SYHRDIDEWTLQIKWAQQRD 131
            ..|.|..||:..||::: .....:|:.....:....:::.     ..|   :||.|.||..|:.|
 Worm   104 FTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELKPRIGDLH---NEWVLTIKNVQESD 165

  Fly   132 AGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPI 196
            .|.|.|||:|:|:...:..|::                                      ...|:
 Worm   166 RGNYSCQINTEPITLSTGELDV--------------------------------------KVPPV 192

  Fly   197 QTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVL---SEETSGGRLKFKT 258
            .:.:.|.|       :.|.:|:.::|||....:|.|.  :.|..||:.:   :..|..|...|. 
 Worm   193 VSRSTPAA-------VEVREGNNVSLTCKADGNPTPT--VIWRRQDRQIIRYNGATGFGASVFH- 247

  Fly   259 IKSEETKSILLIYDADLLHSGKYSCYPSN 287
                  ..:|.:......|..:|.|..||
 Worm   248 ------GPVLHLTKVSRKHMSEYLCVASN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/85 (27%)
IG_like 210..297 CDD:214653 19/81 (23%)
IGc2 217..287 CDD:197706 16/72 (22%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 25/137 (18%)
Ig_3 191..270 CDD:372822 20/94 (21%)
IG 294..380 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.