DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and si:ch211-264f5.6

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_002665524.2 Gene:si:ch211-264f5.6 / 100319064 ZFINID:ZDB-GENE-081104-208 Length:540 Species:Danio rerio


Alignment Length:385 Identity:73/385 - (18%)
Similarity:120/385 - (31%) Gaps:119/385 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ITSLVGKSAYLGCRVKHLGN-KTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDID----EWTL 122
            |..:|||:......|....: .||.|..::...|..|.....:.....:..|...|.    .:.|
Zfish    31 INGVVGKNVTFKTTVVSTPDILTVTWTFNKGQPIAMVTVIPSSNTVSVRPPYVNRISCNRTTFQL 95

  Fly   123 QIKWAQQRDAGVYECQIST---------------QPVRSYSVNLNIVDLIDAETSDIM------- 165
            |:....:.|.|.|...|.|               :||....::.|:::.::..::.::       
Zfish    96 QLGPLVKEDTGEYILTIVTNNGDLVTGQIDLEVLEPVTDVKISSNVLEPVEFNSTVVLTCSAKGS 160

  Fly   166 --QQYYND------DAFYIAENRV---YQSSNDEFAGMFGPIQTVA---------VP-TATILGG 209
              .::.|.      |..::..|.|   .:.|......:.|||..:|         .| ..|:..|
Zfish   161 FTYKWINGSVPLVVDGTHMQLNAVGNELKISEVRRTDLQGPIVCIAENALESGKSAPFNLTVSYG 225

  Fly   210 P----------DLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEET 264
            |          |.|:.||||:.|||..  ...||..|.|......|..........| |:.:.|.
Zfish   226 PENILMNQFPTDTYLKKGSTLTLTCTA--DSNPPATIQWVFNGVNLPSNAVSSPANF-TLNNLEE 287

  Fly   265 KSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQ 329
            |           :||.|:|...|                                        .|
Zfish   288 K-----------NSGNYTCVAYN----------------------------------------AQ 301

  Fly   330 AVRVISTMVAALVLLEACSSLLLQSGGGGGCPGGGS------PAGGMPTRVREIRE-KPL 382
            ..|.|::.||.:.::|:.|...:.|.......|..:      .|.|....|..::: |||
Zfish   302 TKRYIASRVAFVTVVESLSGTNISSSTSLLIAGNSTVNLTCFAAAGRAETVEWVKDGKPL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 19/99 (19%)
IG_like 210..297 CDD:214653 24/96 (25%)
IGc2 217..287 CDD:197706 19/69 (28%)
si:ch211-264f5.6XP_002665524.2 Ig 33..129 CDD:299845 18/95 (19%)
IG_like 33..128 CDD:214653 18/94 (19%)
Ig 130..222 CDD:299845 13/91 (14%)
IG_like 149..222 CDD:214653 10/72 (14%)
I-set 233..315 CDD:254352 28/135 (21%)
Ig_2 235..315 CDD:290606 28/133 (21%)
IGc2 335..398 CDD:197706 6/27 (22%)
Ig_2 427..494 CDD:290606
IG_like 427..479 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.