DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and negr1

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:390 Identity:85/390 - (21%)
Similarity:136/390 - (34%) Gaps:118/390 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSHYPHGH----KWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTY 101
            ||..|.|.    :|  |..|     |:....|::|.|.|.::. |....||:....  |:..|..
 Frog    30 PSCLPAGQSMDFQW--PAVD-----NLVVRQGETAMLRCFLEE-GASKGAWLNRSS--IIFAGGD 84

  Fly   102 TYTTDQR--FQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQ-PVRSYSVNLNI---------- 153
            .::.|.|  ..||..:   |::|:|:.....|.|.|.|.:.|: ..|:..|:|.:          
 Frog    85 KWSVDPRVSIATSSKQ---EYSLRIQKVDVSDDGPYTCSVQTEHSPRTLQVHLTVHVSPKIYDIS 146

  Fly   154 ----------VDLIDAETS----DIMQQYYNDDAFYIAENR---VYQSSNDEFAG---------- 191
                      |.||...|.    .|..::.:..|......:   :|..:.|: ||          
 Frog   147 SDMTVNEGTNVSLICLATGKPEPSISWRHISPSAKQFGSGQYLDIYGITRDQ-AGDYECSAENDV 210

  Fly   192 MFGPIQTVAVP---TATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIF-WYHQDKVLSEETSGG 252
            .|..::.|.|.   ..|||......|..|.|..:.|.....|.|   :| ||..:|.|:....|.
 Frog   211 SFPDVKKVKVTVNFAPTILEITPTGVSLGRTGLIRCETAAVPAP---VFEWYKGEKKLTNGQRGI 272

  Fly   253 RLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN---TEIASIRVHVL---------------- 298
            |     |::..|:|||.:.:....|.|.|:|...|   |..||:.::.:                
 Frog   273 R-----IQNYNTRSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSPVTSSAKYS 332

  Fly   299 -------QGERPEAMQTNAAP----------AAVALACWSCHFGQATQAVRVISTMVAALVLLEA 346
                   ..::|.    .|||          |.:..:||        ..|..:|:..:.:.|..|
 Frog   333 VKHYARSSSDKPH----YAAPSTAQYGITGRAEILFSCW--------YLVLTLSSFTSIIYLKNA 385

  Fly   347  346
             Frog   386  385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 21/82 (26%)
IG_like 210..297 CDD:214653 26/90 (29%)
IGc2 217..287 CDD:197706 21/70 (30%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 27/102 (26%)
FR1 44..62 CDD:409353 6/22 (27%)
Ig strand A' 47..53 CDD:409353 2/10 (20%)
Ig strand B 55..63 CDD:409353 3/7 (43%)
CDR1 63..68 CDD:409353 1/5 (20%)
FR2 69..75 CDD:409353 2/5 (40%)
Ig strand C 69..74 CDD:409353 2/4 (50%)
CDR2 76..87 CDD:409353 2/12 (17%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 11/36 (31%)
Ig strand D 91..98 CDD:409353 2/6 (33%)
Ig strand E 101..107 CDD:409353 2/5 (40%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 3/8 (38%)
FR4 129..136 CDD:409353 2/6 (33%)
Ig_3 140..208 CDD:404760 10/68 (15%)
Ig strand A' 146..151 CDD:409353 0/4 (0%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 1/4 (25%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 0/5 (0%)
Ig strand F 200..207 CDD:409353 1/6 (17%)
Ig strand G 214..222 CDD:409353 2/7 (29%)
Ig_3 226..302 CDD:404760 25/83 (30%)
putative Ig strand A 226..232 CDD:409353 3/5 (60%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand E 281..285 CDD:409353 3/3 (100%)
Ig strand F 295..300 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.