| Sequence 1: | NP_729590.1 | Gene: | Srg2 / 39179 | FlyBaseID: | FBgn0262007 | Length: | 518 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_608766.1 | Gene: | CG3285 / 33547 | FlyBaseID: | FBgn0031522 | Length: | 466 | Species: | Drosophila melanogaster |
| Alignment Length: | 33 | Identity: | 11/33 - (33%) |
|---|---|---|---|
| Similarity: | 14/33 - (42%) | Gaps: | 1/33 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 NPSASIEMSQYENNEVPYSSVGADEVPSSPPKA 42 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Srg2 | NP_729590.1 | DUF2076 | <6..>42 | CDD:430876 | 9/31 (29%) |
| MFS | 115..504 | CDD:475125 | |||
| CG3285 | NP_608766.1 | MFS_GLUT6_8_Class3_like | 26..465 | CDD:340916 | 11/33 (33%) |
| Blue background indicates that the domain is not in the aligned region. | |||||