DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srg2 and CG3285

DIOPT Version :10

Sequence 1:NP_729590.1 Gene:Srg2 / 39179 FlyBaseID:FBgn0262007 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_608766.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster


Alignment Length:33 Identity:11/33 - (33%)
Similarity:14/33 - (42%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NPSASIEMSQYENNEVPYSSVGADEVPSSPPKA 42
            :|:...|...:.|......|| .||.|.|..||
  Fly   106 DPAEEYECPHFLNTCCEKDSV-LDEPPPSATKA 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srg2NP_729590.1 DUF2076 <6..>42 CDD:430876 9/31 (29%)
MFS 115..504 CDD:475125
CG3285NP_608766.1 MFS_GLUT6_8_Class3_like 26..465 CDD:340916 11/33 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.