DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42825 and CG33282

DIOPT Version :9

Sequence 1:NP_729590.1 Gene:CG42825 / 39179 FlyBaseID:FBgn0262007 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:446 Identity:90/446 - (20%)
Similarity:179/446 - (40%) Gaps:88/446 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FQRN----QKNKPQSNAVGAAGLIFISGGMNIAWAI-------GFQGPIYYQTTKHNYIAWF--- 118
            |.:|    ||.:.|..|.....:|....|:.:.|..       ....|:.::..... |:|.   
  Fly     4 FLKNSLLQQKTRYQLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQ-ISWLGSM 67

  Fly   119 --IGAIIGALVTMALTNKVAKKYILQFSSVLVTVGGLVIACTHNNGAGTTAACYLDGIANGLVFA 181
              :.::.|.|....|..:..:|:.|...:.......::|.|. :|.....||.:|.|...|..:.
  Fly    68 LGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCA-SNVYYLYAARFLCGFTGGAGYL 131

  Fly   182 PFMALVGEISVPYLRGKASATLEQLCFGTGILLQILYVSNWTYSSYMTYNDFTSENMKGVLSTIY 246
            .....:.|::...:|| |..::..|....|||      :.:..|:|:.|:             :.
  Fly   132 VVPIFISEVADSNIRG-ALTSMVMLSVDLGIL------AGYILSTYLAYH-------------VV 176

  Fly   247 GVLALIMGSFFTI------ESPVLMLANNEEQAAIDALR--RLQKPAVLTEETYELLAEHKRYLA 303
            ..||:|:...:.|      |:...:|..::..||.::.|  |.|:.|: .|:|.::..|..|...
  Fly   177 PFLAIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAI-CEQTSKVNFEELRTAV 240

  Fly   304 YNKNMSKSESIS-KALPTFMRLAYLRALNAMSI-----SSFVIITYVVAILVSN----DLRNASS 358
            .::....:..:| |.|.|...|....|...:|:     ..|..|.|:..|..::    |: |.::
  Fly   241 LSQQTRNATPLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDV-NTAT 304

  Fly   359 WYIGLAFCRWLGSLIPSFCMESLGRKKPAVFGLLVSCGLSFAVGS-QYNVYTYMSQV-------- 414
            ..|||.  :.:|....:..::.:||:   |..|:.:.|:  .:|. .:..:||::::        
  Fly   305 IIIGLV--QIVGVYTSTILVDIVGRR---VLMLISTMGV--GIGCIAFGCFTYLAKIYDLSDFNW 362

  Fly   415 --TVLIMIFEFFA-----GMAFSSNSAYLTEAYPMGVKQHFIGLTFITEIFVFLII 463
              .||::|..:.|     |:.|    ..|.|.:|:.::..   .|.::.||:.|::
  Fly   363 LPLVLMIIICYVANIGLIGIFF----LVLVELFPVKIRSL---ATSLSVIFLSLLV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42825NP_729590.1 MFS 116..490 CDD:119392 79/387 (20%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 84/429 (20%)
MFS_1 53..409 CDD:284993 79/393 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444426
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.