DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32053 and GEX2

DIOPT Version :9

Sequence 1:NP_729587.1 Gene:CG32053 / 39178 FlyBaseID:FBgn0052053 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_013032.1 Gene:GEX2 / 853981 SGDID:S000001814 Length:615 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:45/176 - (25%)
Similarity:64/176 - (36%) Gaps:39/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 TLAWTSTEVYGDSSGPYVLFGFLRLMGSFTTSFALDSLGRKIPLLLGLVISGCLACG-------- 368
            |.:.|||              |.:|..:...|...|||..||     |:||....||        
Yeast    33 TYSMTST--------------FFKLKENEIMSAQFDSLKYKI-----LLISTAFVCGFGISLDYT 78

  Fly   369 LASRFAGSHPLTFSGNRMALWLLLIYQLFAGIAFAPSS---SYLSEAFPRRIKRPCIAITYILEI 430
            |.|.:.|....::|.:.    ||...|:...:....|.   |.||:.|.|........|.||:..
Yeast    79 LRSTYTGYATNSYSEHS----LLSTVQVINAVVSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGT 139

  Fly   431 IVQLLLRQMDFAAIGS---DSSYVALYFFILGGLLLAGFLFSVWYM 473
            |:|....::...|.||   :..||.....:.  |:|:.|....|.|
Yeast   140 IIQSQATRLTMYAAGSVFYNCGYVGTNLLLT--LILSDFSSLKWRM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32053NP_729587.1 MFS 73..428 CDD:119392 32/126 (25%)
GEX2NP_013032.1 MFS_ARN_like 59..571 CDD:340880 35/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.