DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32053 and PGLCT

DIOPT Version :9

Sequence 1:NP_729587.1 Gene:CG32053 / 39178 FlyBaseID:FBgn0052053 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_568328.1 Gene:PGLCT / 831472 AraportID:AT5G16150 Length:546 Species:Arabidopsis thaliana


Alignment Length:481 Identity:107/481 - (22%)
Similarity:179/481 - (37%) Gaps:89/481 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LRNQPQANA-----VGAAALIFLTGGVHIAWSIGF------DSSLSELEVTNHVQICWFI----- 98
            ||::.:::.     ||.|.|..:..|.|:....|.      |..::|    |.|...|.:     
plant    95 LRSEGKSSGTVLPFVGVACLGAILFGYHLGVVNGALEYLAKDLGIAE----NTVLQGWIVSSLLA 155

  Fly    99 GAIIGALLGGFFSRWFPYKTLMEFCSLITITGGIVMAVNRMDLDALLAGRYMNGLANGLAIAPTL 163
            ||.:|:..||..:..|. :|.......|.:..|..:......:..::.||.:.|:..|::.|...
plant   156 GATVGSFTGGALADKFG-RTRTFQLDAIPLAIGAFLCATAQSVQTMIVGRLLAGIGIGISSAIVP 219

  Fly   164 AMAGELSVFYKRGTTTSAAEQWPTTIGIFVQIVCSHSWDVQSDFTEEQFQGVLSGVLGSIALLLA 228
            ....|:|....||...| ..|....|||...::..........:....| ||  .|:.|:.|.:.
plant   220 LYISEISPTEIRGALGS-VNQLFICIGILAALIAGLPLAANPLWWRTMF-GV--AVIPSVLLAIG 280

  Fly   229 FLLSIESPVDLLEQGNEQGAVQALSRLQRPRAVTAETYDQVRD-----------HRTYVEHHRSM 282
            ...|.|||..|::||....|.:|:..|.....|.    :.|||           ...:.:...|.
plant   281 MAFSPESPRWLVQQGKVSEAEKAIKTLYGKERVV----ELVRDLSASGQGSSEPEAGWFDLFSSR 341

  Fly   283 GWR-----HALPALVRLSVLRALYALSLSVMVAFTLAWTSTEVYGDSSGPYVLFGFLRLMGSFTT 342
            .|:     .||....:|:.:.|:...|.||   |..|...::|...:     |.|...:.|:...
plant   342 YWKVVSVGAALFLFQQLAGINAVVYYSTSV---FRSAGIQSDVAASA-----LVGASNVFGTAVA 398

  Fly   343 SFALDSLGRKIPLLL---GLVISGCLACGLASRFAGSHPLTFSGNRMALWLLLIYQLFAGIAFAP 404
            |..:|.:|||..||.   |:.:|..|   |:..|.......:||. :|:...::|.|...:...|
plant   399 SSLMDKMGRKSLLLTSFGGMALSMLL---LSLSFTWKALAAYSGT-LAVVGTVLYVLSFSLGAGP 459

  Fly   405 -SSSYLSEAFPRRIKRPCIAIT-------------YILEIIVQLLLRQMDFAAIGSDSSYVALYF 455
             .:..|.|.|..||:...:|::             |.|.::.:          .|..|.|:.   
plant   460 VPALLLPEIFASRIRAKAVALSLGMHWISNFVIGLYFLSVVTK----------FGISSVYLG--- 511

  Fly   456 FILGGLLLAGFLFSVWYMPETKDTTL 481
              ..|:.:...|:....:.|||..:|
plant   512 --FAGVCVLAVLYIAGNVVETKGRSL 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32053NP_729587.1 MFS 73..428 CDD:119392 89/398 (22%)
PGLCTNP_568328.1 MFS 109..524 CDD:119392 101/454 (22%)
Sugar_tr 111..539 CDD:278511 103/465 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.