DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32053 and CG8837

DIOPT Version :9

Sequence 1:NP_729587.1 Gene:CG32053 / 39178 FlyBaseID:FBgn0052053 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster


Alignment Length:433 Identity:93/433 - (21%)
Similarity:160/433 - (36%) Gaps:72/433 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EVTNHVQICW-----FIGAIIGALLGGFFSRWFPYKTLMEFCSLITITGGIVMAVNRMDLDALLA 146
            :.|:.....|     |:.|.:|||:.||.:.....|:::....|:.|:|...:... .|:..:.|
  Fly    51 QATDPAGTAWLTGYLFLSAALGALVSGFLALKIGPKSVLLCSGLLQISGWACIHFG-YDIVHIYA 114

  Fly   147 GRYMNGLANGLAIAPTLAMAGELSVF-YKRGTTTSAAEQWPTTIGIFVQIVCSHSWDVQSDFTEE 210
            .|...|:|:|.|.........|::.. .|....|...|.| .|:||.:..|...       :...
  Fly   115 SRLFAGVASGAAFVVLPIFINEIAESREKAARLTFTIELW-RTLGILIGFVLGF-------YVPY 171

  Fly   211 QFQGVLSGVLGSIALLLAFLLSIESPVDLLEQGNEQGAVQALSRLQRPRAVTAETYDQVR--DHR 273
            .|..:: |...|....:.|....|||...|.:.|       ::.|::    :...|..:|  |.|
  Fly   172 AFVNIV-GCAVSFVFTMTFPFVQESPHYYLRKNN-------MASLEK----SLRWYRGIRDIDDR 224

  Fly   274 TYVEHHRSMGWRHA-----------LPA----LVRLSVLRALYALSLSVMVAFTLAWTSTEVYG- 322
            ...|:...:...||           .|.    ::||:.:..|..:...:...|.....:.:..| 
  Fly   225 EKPEYLSELNEFHAELRSRDKNVGSTPMSHGYIIRLTFVSFLLTVCAKLSGVFVELNYAADFLGR 289

  Fly   323 ---DSSGPYVLFGFLRLMGSFTTSFALDSLGRKIPLLLGLVISGCLACGLASRFAGSHPLTFSGN 384
               .:...||:....:..|:.........|.||:.|.|..:.:......||...|..| |...||
  Fly   290 TGYSTETNYVVLASAQCAGALLARLVGPRLPRKLLLCLSSLFAAAAVIALALFKAYGH-LWLLGN 353

  Fly   385 RMALW-------LLLIYQLFAGIAFA--PSSSYL-SEAFPRRIKRPCIAITYILEIIVQLLLRQM 439
                |       :||..|| |.::|.  |.::.: ||..|.::.    .:.|.|...|..||...
  Fly   354 ----WADRYLPIILLAIQL-ALVSFGLYPLAAVVSSEVLPTKLH----DLLYSLASAVSWLLLFG 409

  Fly   440 DFAAIGSDSSYVA----LYFFILGGLLLAGFLFSVWYMPETKD 478
            ...|..:..:.:|    ||.::..|..:...|.|:..:|||::
  Fly   410 MIEAFNAVKATIAPGLLLYLWVFAGASIFVGLISLPLLPETRN 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32053NP_729587.1 MFS 73..428 CDD:119392 79/377 (21%)
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 32/147 (22%)
Sugar_tr 58..453 CDD:278511 92/426 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.