DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32053 and Slc2a6

DIOPT Version :9

Sequence 1:NP_729587.1 Gene:CG32053 / 39178 FlyBaseID:FBgn0052053 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001100032.1 Gene:Slc2a6 / 296600 RGDID:1309317 Length:321 Species:Rattus norvegicus


Alignment Length:296 Identity:69/296 - (23%)
Similarity:122/296 - (41%) Gaps:41/296 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LLLAFLLSIESPVDLLEQGNEQGAVQALSRLQRPRAVTAETYDQVRDHRTYVEHHRS-MGWRHA- 287
            |||:|:.:  ||..||.:..::.|:|||..|:....|..| ::|::|:   |....| :.|..| 
  Rat    26 LLLSFMPN--SPRFLLSKSRDEEALQALIWLRADSEVHWE-FEQIQDN---VRRQSSRVSWAEAW 84

  Fly   288 -----LPALVRLSVLRALYALS--LSVMVAFTLAWTSTEVYGDSSGPYVLFGFLRLMGSFTTSFA 345
                 .|.|:.: ::|.|..|:  ..::|.....:.||.|...|.....:.|.:||:.....:..
  Rat    85 EPRVYRPILITV-LMRFLQQLTGITPILVYLQTIFDSTSVVLPSQQDAAIVGAVRLLSVLIAAVT 148

  Fly   346 LDSLGRKIPLLL--GLVISGCLACGLASRF-----------------AGSHPLTFSGNRMALWLL 391
            :|..|||:.|.:  .::....|..||..:.                 ....|...:.|.:.|..|
  Rat   149 MDLAGRKVLLYVSASIMFVANLTLGLYVQLVPRTLTPNSTVEIVTLGGTEQPPAAAFNYLTLIPL 213

  Fly   392 LIYQLFA---GIAFAPSSSYL-SEAFPRRIKRPCIAITYILEIIVQLLLRQMDFAAIGSDSSYVA 452
            |...||.   .:.:.|.:..| ||..|.|.:.....:..::..:...:|.:....|:.:....|.
  Rat   214 LATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVLVSWLTAFVLTKYFLLAVNAFGLQVP 278

  Fly   453 LYFFILGGLLLAGFLFSVWYMPETKDTTLLQAQFKF 488
            .:||  ..:.|...||:...:|||:..:|.|.:..|
  Rat   279 FFFF--SAICLLSLLFTGCCVPETRGRSLEQIEAFF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32053NP_729587.1 MFS 73..428 CDD:119392 55/234 (24%)
Slc2a6NP_001100032.1 MFS <89..293 CDD:119392 41/206 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.