DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32053 and CG33281

DIOPT Version :9

Sequence 1:NP_729587.1 Gene:CG32053 / 39178 FlyBaseID:FBgn0052053 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster


Alignment Length:480 Identity:102/480 - (21%)
Similarity:173/480 - (36%) Gaps:108/480 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LIFLTGGVHIAWSIGFDSSLSELEVTNH----------------VQICWFIGAIIGALLGGFFSR 112
            :|.::.|....|.   .||..||...|.                ..||      :|.|:|.|...
  Fly    19 IISISYGAFCGWP---SSSFLELSSENSPLDTGPLTPTDQGWVASNIC------LGGLVGTFLFT 74

  Fly   113 WFPYKTLMEFC----SLITITGGIVMAVNRMDLDALLAGRYMNGLANGLAIAPTLAMAGELSVFY 173
            |...:...:.|    :|..:.|.:::...|..:..::| |::.|.|.|...........||:...
  Fly    75 WLADRIGRKLCLMWMALPNLLGWVIIPFARTPMHLIIA-RFIGGAAGGGCFTVIPIYIAELASDN 138

  Fly   174 KRGTTTSAAEQWPTTIGIFVQIVCSHSWDVQSDFTEEQFQGVLSGVLG---------------SI 223
            .||           .:|:|:.:.|:             |..||:.|||               |.
  Fly   139 IRG-----------ILGVFLVLTCN-------------FGLVLAFVLGYYFNYAQVSWIVSSLSF 179

  Fly   224 ALLLAFLLSIESPVDLLEQGNEQGAVQALS-------------------RLQRPRAVTAETYDQV 269
            ..:..|....|:|..|.:....:.|..:|.                   .||:.:.....|.|.|
  Fly   180 VFVGCFWFMPETPQHLAKINKIEEAEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGV 244

  Fly   270 RDHRTYVEHHRSMGWRHALPALVRLSVLRALYALSLSVMVA--FTLAWTST--EVYGDSSGPYV- 329
            .|.    :....:.|........|.:.|..|..:|.:.:..  ..|.:|:.  |..|.|..|.| 
  Fly   245 DDD----DAATGVTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQAGSSLPPTVA 305

  Fly   330 --LFGFLRLMGSFTTSFALDSLGRKIPLLLGLVISGC--LACGLASRF--AGSHPLTFSGNRMAL 388
              :.|.::|||::.::..::.|||||.||:..|..|.  .|.|..|.|  .|....:||...:|.
  Fly   306 AIIVGVIQLMGTYASTVLVERLGRKILLLVSAVGIGLGQSAMGTYSYFQMLGCPVASFSWVPIAG 370

  Fly   389 WLLLIYQLFAGIAFAPSSSYLSEAFPRRIKRPCIAITY-ILEIIVQLLLRQMDFAAIGSDSSYVA 452
            :..:::....|:...| ...:||..|::|:...|.|.. .|.:|....::.|   .:.::|..:.
  Fly   371 FSFMLFLAAVGLLSLP-FLVVSEIMPQKIRSTAIMILMSTLWLISTCAVKLM---PVFTESLGMH 431

  Fly   453 LYFFILGGLLLAGFLFSVWYMPETK 477
            ...|:...|.....:|...::||||
  Fly   432 GTVFMFASLSFLAAIFIAIFVPETK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32053NP_729587.1 MFS 73..428 CDD:119392 89/420 (21%)
CG33281NP_995620.1 MFS 50..452 CDD:119392 90/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.