DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6674 and AT5G13970

DIOPT Version :9

Sequence 1:NP_648377.1 Gene:CG6674 / 39174 FlyBaseID:FBgn0036063 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_196901.1 Gene:AT5G13970 / 831245 AraportID:AT5G13970 Length:404 Species:Arabidopsis thaliana


Alignment Length:162 Identity:33/162 - (20%)
Similarity:64/162 - (39%) Gaps:39/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RGTALDQSKAK---AFSINALDRGNKSGNESGQVMNYRQGRSIVTGLDAEDGRLRRMRGKESIFK 84
            |....|.||:.   .||.:..||....|:..          |::......:.::      |::: 
plant   228 RENQADDSKSPKRVRFSSDVKDRTLTEGDND----------SVMEASSPNEDKV------EAVY- 275

  Fly    85 KPELPIGRCLKPRKTPDYQVNPHKWKKYSLSDVDISEQSNSAAALSFLRQMDAQREAEGVDNESP 149
                       |...|||..||.|:.:|:....::.|:||..|.:.||..:.::.|:        
plant   276 -----------PTGIPDYMRNPSKYTRYTFESGEVDEESNRKAYMDFLNMIRSKDES-------- 321

  Fly   150 PTDGKIEFKRTSKLSRKLKSLKQQEVDDVELD 181
            ..|..:|..|:.....|.|.:.:.:|::::.|
plant   322 LVDPLMELPRSVAFVPKRKPMAESKVENIDKD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6674NP_648377.1 TSSC4 9..149 CDD:291916 26/128 (20%)
AT5G13970NP_196901.1 TSSC4 <279..312 CDD:373696 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006071
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13445
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.