DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6674 and Tssc4

DIOPT Version :9

Sequence 1:NP_648377.1 Gene:CG6674 / 39174 FlyBaseID:FBgn0036063 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_017177874.1 Gene:Tssc4 / 56844 MGIID:1861712 Length:386 Species:Mus musculus


Alignment Length:236 Identity:55/236 - (23%)
Similarity:90/236 - (38%) Gaps:73/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSAKRDALFACLDDASKELRGTALDQSKAKAFSINALDRGNKSGNESGQVMNYRQGRSIVTGLDA 68
            ||.:..::|.||:.|::        |:...|...:..|.|           ::|  |.:......
Mouse   155 FSQRSHSIFDCLESAAR--------QAPCSAPQTSVSDNG-----------SFR--RPVTPPSQT 198

  Fly    69 EDGRLRRMRGKESIFKKPELPIGRCLKPRKTPDYQVNPHKWKKYSLSDV-DISEQSNSAAALSFL 132
            ....|.|:.|.....:  .||:         |||..:|.:|.||||.|| :.|||||..|||:||
Mouse   199 PARGLSRVHGNTGPTR--VLPV---------PDYVSHPERWTKYSLEDVSEASEQSNRDAALAFL 252

  Fly   133 RQMDAQREAEGVD--NESPPT--DGKIEFKRTSKLSRKLKSLKQQEVDDVELDKPQLRGSKLVMP 193
            .........:.|.  |:.|.:  :|::.|         .|.::..|.          |..:    
Mouse   253 SSRSQVSHTDYVPSFNQDPSSCGEGRVVF---------TKPVRDSEA----------RAER---- 294

  Fly   194 EYVIGQKPHKPKKCKTKSEQSRAAGK--LQLSHLAEEDEQD 232
                       |:...|...|.|.|:  ::|:|||..:.::
Mouse   295 -----------KRVLKKGVGSGAGGEAAVELAHLAGPEAEE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6674NP_648377.1 TSSC4 9..149 CDD:291916 38/142 (27%)
Tssc4XP_017177874.1 TSSC4 160..276 CDD:373696 39/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B0B3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006071
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13445
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8177
SonicParanoid 1 1.000 - - X5789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.