DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6674 and Tssc4

DIOPT Version :9

Sequence 1:NP_648377.1 Gene:CG6674 / 39174 FlyBaseID:FBgn0036063 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001013212.2 Gene:Tssc4 / 361682 RGDID:1307043 Length:321 Species:Rattus norvegicus


Alignment Length:259 Identity:56/259 - (21%)
Similarity:90/259 - (34%) Gaps:119/259 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSAKRDALFACLDDASKELRGTALDQSKAKAFSINALDRGNKSGNESGQVMNYRQGRSIVTGLDA 68
            ||.:..::|.||:.|::        |....|...:.:|..:                        
  Rat    90 FSQRSHSIFDCLESAAR--------QEPCSAPQTSVVDNCS------------------------ 122

  Fly    69 EDGRLRRMRGKESIFKKPELPIGRCLKPRKT--------------------PDYQVNPHKWKKYS 113
                          ||:|..|      |.:|                    |||..:|.:|.|||
  Rat   123 --------------FKRPVAP------PSQTPARSLSRVHGNTDPTRVHPVPDYVSHPERWTKYS 167

  Fly   114 LSDV-DISEQSNSAAALSFLRQMDAQREAEGVD-----NESPPT--DGKIEFKRTSKLSRKLKSL 170
            |.|| :.|||||..|||:||   .::.:|...|     |:.|.:  :|::.|             
  Rat   168 LEDVSETSEQSNRDAALAFL---SSRSQASPTDYVPFFNQDPSSCGEGRVVF------------- 216

  Fly   171 KQQEVDDVELDKPQLRGSKLVMPEYVIGQKPHKPKKCKTKSEQSRAAGK--LQLSHLAEEDEQD 232
                      .|| :|||          :...:.|:...|...|.|.|:  ::|:|||..:.::
  Rat   217 ----------TKP-VRGS----------EARAERKRVLKKGVVSGAGGEASVELAHLAGPEAEE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6674NP_648377.1 TSSC4 9..149 CDD:291916 37/165 (22%)
Tssc4NP_001013212.2 TSSC4 95..211 CDD:291916 38/170 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354547
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B0B3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006071
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13445
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.