DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6674 and TSSC4

DIOPT Version :9

Sequence 1:NP_648377.1 Gene:CG6674 / 39174 FlyBaseID:FBgn0036063 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001284587.1 Gene:TSSC4 / 10078 HGNCID:12386 Length:329 Species:Homo sapiens


Alignment Length:229 Identity:58/229 - (25%)
Similarity:88/229 - (38%) Gaps:62/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSAKRDALFACLDDASKELRGTALDQSKAKAFSINALDRGNKSGNESGQVMNYRQ-----GRSIV 63
            ||.:...:|.||:.|::....:....|.:        |.|           .:::     |||.|
Human    89 FSQRSRDIFDCLEGAARRAPSSVAHTSMS--------DNG-----------GFKRPLAPSGRSPV 134

  Fly    64 TGLDAEDGRLRRMRGKESIFKKPELPIGRCLKPRKTPDYQVNPHKWKKYSLSDV-DISEQSNSAA 127
            .||    ||..|...      .|.:|        ..|||..:|.:|.||||.|| ::|||||.|.
Human   135 EGL----GRAHRSPA------SPRVP--------PVPDYVAHPERWTKYSLEDVTEVSEQSNQAT 181

  Fly   128 ALSFLRQMDAQREAEGVDNESPPTDGKIEFKRTSKLSRKLKSLKQQEVDDVELDKPQLRGSKLVM 192
            ||:||          |..:.:.|||....|.:......:.:.:..:.|..||....:.|      
Human   182 ALAFL----------GSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKR------ 230

  Fly   193 PEYVIGQKPHKPKKCKTKSEQSRAAGKLQLSHLA 226
               |:|:.....:.........|..|.::|:|||
Human   231 ---VLGKVGEPGRGGLGNPATDRGEGPVELAHLA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6674NP_648377.1 TSSC4 9..149 CDD:291916 40/145 (28%)
TSSC4NP_001284587.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88
TSSC4 94..210 CDD:291916 44/162 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..156 16/88 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..329 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B0B3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006071
OrthoInspector 1 1.000 - - oto89548
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13445
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8177
SonicParanoid 1 1.000 - - X5789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.