DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and CASP6

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001217.2 Gene:CASP6 / 839 HGNCID:1507 Length:293 Species:Homo sapiens


Alignment Length:280 Identity:75/280 - (26%)
Similarity:131/280 - (46%) Gaps:47/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YKMQSRFNRGVLLMVN------IMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQF 245
            |||..| .||:.|:.|      .:..|:  ||...|::|  :|...|.:|.|.:..:.::..::.
Human    37 YKMDHR-RRGIALIFNHERFFWHLTLPE--RRGTCADRD--NLTRRFSDLGFEVKCFNDLKAEEL 96

  Fly   246 FKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKP 310
            ...:..|::.|:. :.:|||.|.::||   ||.....:  .:.:::|.:...|:..||..||.||
Human    97 LLKIHEVSTVSHA-DADCFVCVFLSHG---EGNHIYAY--DAKIEIQTLTGLFKGDKCHSLVGKP 155

  Fly   311 KVLMFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNV--------PSLADT 367
            |:.:...|||:::|:           ||.....   .|.|||.:.:..|.|        |:.||.
Human   156 KIFIIQACRGNQHDV-----------PVIPLDV---VDNQTEKLDTNITEVDAASVYTLPAGADF 206

  Fly   368 LVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVGNKR-------TKKG 425
            |:||:...||.:||:...||||||..|:::..:....:..::|...:..|..:|       :..|
Human   207 LMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIG 271

  Fly   426 SMQTGAYDNLGFNKKLYFNP 445
            ..|...:.:: ..|||:|.|
Human   272 KKQVPCFASM-LTKKLHFFP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 73/276 (26%)
CASP6NP_001217.2 CASc 37..290 CDD:214521 74/278 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.