DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Casp6

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001258913.1 Gene:Casp6 / 83584 RGDID:70967 Length:277 Species:Rattus norvegicus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:131/277 - (47%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YKMQSRFNRGVLLMVN------IMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQF 245
            |||..: .||..|:.|      .:..|:  ||...|::|  :|...|.||.|.:..:.::..::.
  Rat    20 YKMDHK-RRGTALIFNHERFFWHLALPE--RRGTNADRD--NLTRRFSELGFEVKCFNDLRAEEL 79

  Fly   246 FKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKP 310
            ...:..|::||:| :.:||:.|.::||   ||.....:  .:.:::|.:...|:..||..||.||
  Rat    80 LLKIHEVSTSSHV-DADCFLCVFLSHG---EGNHIYAY--DAKIEIQTLTGLFKGDKCQSLVGKP 138

  Fly   311 KVLMFPFCRGDEYDLGHPKNQGNLMEPVYTA-----QEEKWPDTQTEGIPSPSTNVPSLADTLVC 370
            |:.:...|||.::|:           ||...     |.:|..|..|:...:....:|:.||.|:|
  Rat   139 KIFIIQACRGSQHDV-----------PVVPLDVVDHQTDKLDDNVTQVDAASVYTLPAGADFLMC 192

  Fly   371 YANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVGNKRT-------KKGSMQ 428
            |:...||.:||:...||||||..|:::|.|....:..::|...:..|..:|.       ..|..|
  Rat   193 YSVAEGYYSHRETVNGSWYIQDLCEMLARHGSSLEFTELLTLVNRKVSQRRVDFCKDPGAIGKKQ 257

  Fly   429 TGAYDNLGFNKKLYFNP 445
            ...:.:: ..|||:|.|
  Rat   258 VPCFASM-LTKKLHFCP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 74/273 (27%)
Casp6NP_001258913.1 CASc 20..273 CDD:214521 75/275 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.