DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and CASP1

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001244047.1 Gene:CASP1 / 834 HGNCID:1499 Length:404 Species:Homo sapiens


Alignment Length:438 Identity:88/438 - (20%)
Similarity:177/438 - (40%) Gaps:69/438 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RLAMECVQQGILT--VQMLRNTQDLNGKPFNMDEKD--VRVEQHRRLLLKITQRGPTAYNLLINA 93
            :|.:..:.:|.:.  :..|..|:.||.:.....:::  ..:::.|.|:..:..:|..|..:.|..
Human    11 KLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITY 75

  Fly    94 LRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIVDT-PSPEASEGPCVSKLRNEPLGA 157
            :...:...|..|..|.|::...  ::::.:      |..::.: |:|:|.:.       |..:..
Human    76 ICEEDSYLAGTLGLSADQTSGN--YLNMQD------SQGVLSSFPAPQAVQD-------NPAMPT 125

  Fly   158 LTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKS 222
            .:...|.|....::::::|....||.:  |.:..:.:|..|.::...:..|...||.|||.|...
Human   126 SSGSEGNVKLCSLEEAQRIWKQKSAEI--YPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITG 188

  Fly   223 LIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFV------------MVLMTHG--N 273
            :..|.|.|.:::    :|.::        :|:|......|.|.            :|.|:||  .
Human   189 MTMLLQNLGYSV----DVKKN--------LTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIRE 241

  Fly   274 SVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRGDEYDLGHPKN----QGNL 334
            .:.||:..|... .::.:..|.:...|..||.|.:||||::...||||...:...|:    .|||
Human   242 GICGKKHSEQVP-DILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNL 305

  Fly   335 MEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCY-ANTPGYVTHRDLDTGSWYIQKFCQVMA 398
            ..|.            ||.....:.....:....:.: ::||..|:.|....||.:|.:..:.|.
Human   306 SLPT------------TEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQ 358

  Fly   399 DHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLGFNKKLYFNPG 446
            ::|...|:|:|.:|...:.   ....|..|....:.:...:..|..||
Human   359 EYACSCDVEEIFRKVRFSF---EQPDGRAQMPTTERVTLTRCFYLFPG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 12/76 (16%)
CASc 186..443 CDD:237997 60/275 (22%)
CASP1NP_001244047.1 CARD_CASP1-like 5..87 CDD:260036 12/75 (16%)
CASc 153..402 CDD:214521 61/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152744
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.