DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Pycard

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_075747.3 Gene:Pycard / 66824 MGIID:1931465 Length:193 Species:Mus musculus


Alignment Length:66 Identity:18/66 - (27%)
Similarity:30/66 - (45%) Gaps:14/66 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 VSKLRNEPLGALTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQ---SRFNRGVLLMVNIMDYPD 208
            :.:.|:..|.||..    :.|.|:||.|       ..|.|.:::   .|..||.||.::.:|..|
Mouse     1 MGRARDAILDALEN----LSGDELKKFK-------MKLLTVQLREGYGRIPRGALLQMDAIDLTD 54

  Fly   209 Q 209
            :
Mouse    55 K 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 8/27 (30%)
PycardNP_075747.3 Pyrin_ASC-like 5..86 CDD:260033 18/62 (29%)
CARD_ASC_NALP1 111..191 CDD:260039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.