powered by:
Protein Alignment Dronc and Pycard
DIOPT Version :9
Sequence 1: | NP_524017.1 |
Gene: | Dronc / 39173 |
FlyBaseID: | FBgn0026404 |
Length: | 450 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_075747.3 |
Gene: | Pycard / 66824 |
MGIID: | 1931465 |
Length: | 193 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 30/66 - (45%) |
Gaps: | 14/66 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 VSKLRNEPLGALTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQ---SRFNRGVLLMVNIMDYPD 208
:.:.|:..|.||.. :.|.|:||.| ..|.|.::: .|..||.||.::.:|..|
Mouse 1 MGRARDAILDALEN----LSGDELKKFK-------MKLLTVQLREGYGRIPRGALLQMDAIDLTD 54
Fly 209 Q 209
:
Mouse 55 K 55
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167842787 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.