DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Pycard

DIOPT Version :10

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_075747.3 Gene:Pycard / 66824 MGIID:1931465 Length:193 Species:Mus musculus


Alignment Length:66 Identity:18/66 - (27%)
Similarity:30/66 - (45%) Gaps:14/66 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 VSKLRNEPLGALTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQ---SRFNRGVLLMVNIMDYPD 208
            :.:.|:..|.||..    :.|.|:||.|       ..|.|.:::   .|..||.||.::.:|..|
Mouse     1 MGRARDAILDALEN----LSGDELKKFK-------MKLLTVQLREGYGRIPRGALLQMDAIDLTD 54

  Fly   209 Q 209
            :
Mouse    55 K 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 8/27 (30%)
PycardNP_075747.3 Pyrin_ASC-like 5..86 CDD:260033 18/62 (29%)
CARD_ASC_NALP1 111..191 CDD:260039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.