DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and casp6b.2

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_017210076.1 Gene:casp6b.2 / 664751 ZFINID:ZDB-GENE-060312-12 Length:265 Species:Danio rerio


Alignment Length:265 Identity:74/265 - (27%)
Similarity:130/265 - (49%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RGVLLMVNIMDYPDQN-RRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYV 258
            ||:.|:.|..|:.... :.|.|.:||..||:..|:||:|.:..|.:.::|:..|.:..|.::.:|
Zfish    26 RGLALIFNQKDFSLLGLKTRKGTDKDRDSLVSRFEELDFEVKAYNDYSRDKVLKEIKEVAAADHV 90

  Fly   259 QNTECFVMVLMTHGNSVEGKEKVEFCDGSV------VDMQKIKDHFQTAKCPYLVNKPKVLMFPF 317
             :.:|||.:.::||.           ||.|      :.:.:|.|.|:..||..||.|||:.::..
Zfish    91 -DADCFVCIFLSHGE-----------DGHVYANDEKIKIPEITDLFKGDKCRGLVGKPKIFIWQA 143

  Fly   318 CRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQT--EGIPSPSTNVPSLADTLVCYANTPGYVTH 380
            ||||:.|           :||.....|...|...  .|:   |..:|:.||.::||:.|.|:.:.
Zfish   144 CRGDKKD-----------DPVAPMSAEDSDDEMAVDAGV---SNTLPAGADFIMCYSTTEGFCSF 194

  Fly   381 RDLDTGSWYIQKFCQVMADHAHDTDLEDIL-----KKTSEAVGNKRTKKGSMQTGAYDNLGFNKK 440
            ||...|:||||..|::|..:....:..:||     |.:..::.:..:..|:.|...:.:: ..|:
Zfish   195 RDPLNGTWYIQDLCEIMGRYRSQLEFTNILTLVNRKVSLRSICDDLSATGTKQMPCFASM-LTKR 258

  Fly   441 LYFNP 445
            |:|.|
Zfish   259 LFFRP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 72/261 (28%)
casp6b.2XP_017210076.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.