powered by:
Protein Alignment Dronc and CARD18
DIOPT Version :9
Sequence 1: | NP_524017.1 |
Gene: | Dronc / 39173 |
FlyBaseID: | FBgn0026404 |
Length: | 450 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_067546.1 |
Gene: | CARD18 / 59082 |
HGNCID: | 28861 |
Length: | 90 |
Species: | Homo sapiens |
Alignment Length: | 49 |
Identity: | 12/49 - (24%) |
Similarity: | 25/49 - (51%) |
Gaps: | 8/49 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 MECVQQGILTVQMLRNTQDLNGKPFNMDEKDVRVEQHRRLLLKITQRGP 84
::|:.:..:..| :|:|.. .||.|..:::.|.|:..:|.:||
Human 26 LDCLLEDEVISQ-----EDMNKV---RDENDTVMDKARVLIDLVTGKGP 66
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165152740 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3573 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.