DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and casp7

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001018443.1 Gene:casp7 / 553634 ZFINID:ZDB-GENE-050522-506 Length:316 Species:Danio rerio


Alignment Length:275 Identity:70/275 - (25%)
Similarity:118/275 - (42%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YKMQSRFNRGVLLMVNIMDYPDQNRRRI--GAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLL 249
            ||| |....|..:::|..::.::....:  |.::|:..|...|:.|.|.:..|.:.......:||
Zfish    71 YKM-SHQRVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKSLGFDVAVYNDQTCRNMERLL 134

  Fly   250 TMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLM 314
            ..|:...: .::.||..:|::||.  ||  .:...||: :.::.:...|:...|..||.|||:..
Zfish   135 KAVSEEDH-SDSSCFACILLSHGE--EG--MIYGTDGA-MPIKTMTSLFKGDVCKSLVGKPKLFF 193

  Fly   315 FPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVT 379
            ...|||.|:|.|...:.|.             |:...|...:|...:|..||.|..|:..|||.:
Zfish   194 IQACRGSEFDDGVQTDSGP-------------PNDTIETDANPRHKIPVEADFLFAYSTVPGYYS 245

  Fly   380 HRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVGNK----------RTKKG-----SMQT 429
            .|:...|||::|..|.|:::.....::..||.:.:..|...          ..||.     ||.|
Zfish   246 WRNPGRGSWFVQALCNVLSEFGKQLEIMQILTRVNYMVATSFESWSEDPRFSEKKQIPCVVSMLT 310

  Fly   430 GAYDNLGFNKKLYFN 444
                     |:||||
Zfish   311 ---------KELYFN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 67/272 (25%)
casp7NP_001018443.1 CASc 71..315 CDD:237997 67/272 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.