DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and casp6a

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001018333.1 Gene:casp6a / 552927 ZFINID:ZDB-GENE-030825-4 Length:298 Species:Danio rerio


Alignment Length:291 Identity:73/291 - (25%)
Similarity:128/291 - (43%) Gaps:66/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 FNRGVLLMVNIMDYPDQNRR--------------------RIGAEKDSKSLIHLFQELNFTIFPY 237
            ||:.:..|....:|...::|                    |.|...|.::||..|:||||.:..:
Zfish    34 FNQSIFSMDPNQEYDMNHKRRGMALIFNHENFFWKLGLGYRSGTNADKENLIRRFRELNFEVKAF 98

  Fly   238 GNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQTAK 302
            .:..:.:....:|...::.:| :.:|.|.|.::||.:    ..|...||. :::.:|.|.|:..|
Zfish    99 DDYKRHEVLSKITEAAAADHV-DADCLVCVFLSHGEN----GHVYANDGQ-IEIPEITDLFKGDK 157

  Fly   303 CPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTN------- 360
            |..||.|||:.::..||||::|           :||          |..:.:.|..||       
Zfish   158 CRSLVGKPKIFIWQACRGDKHD-----------DPV----------TPMDVVDSQVTNDMVVDAG 201

  Fly   361 ----VPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVG--- 418
                :|:.||.::||:...||.:||:...||||||..|:::..:..:.:..:||...:..|.   
Zfish   202 VLYTLPAGADFIMCYSVAEGYYSHRETVNGSWYIQDLCEILRRYGSELEFAEILTLVNRKVSLRS 266

  Fly   419 ----NKRTKKGSMQTGAYDNLGFNKKLYFNP 445
                ..|:..|..|...:.:: ..|||:|.|
Zfish   267 VLNCKDRSAVGKKQVPCFASM-LTKKLFFRP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 71/287 (25%)
casp6aNP_001018333.1 CASc 47..294 CDD:237997 68/274 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587220
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.