DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and GPR89B

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001337109.1 Gene:GPR89B / 51463 HGNCID:13840 Length:455 Species:Homo sapiens


Alignment Length:99 Identity:22/99 - (22%)
Similarity:41/99 - (41%) Gaps:18/99 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GKPFNMDEKDVRVEQHRRLLLKITQRGPTAYNLL-----INA--------LRNINCLDAAV---- 104
            |.||.:......:....:|:.::...|.|...||     :|.        |||:...|...    
Human   128 GDPFPILSPKHGILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERR 192

  Fly   105 LLESVDESDSRPPFISLNERRTSRKSADIVDTPS 138
            ||:::|...|:...::: .|||..:..::.:.||
Human   193 LLQTMDMIISKKKRMAM-ARRTMFQKGEVHNKPS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 13/65 (20%)
CASc 186..443 CDD:237997
GPR89BNP_001337109.1 GPHR_N 140..207 CDD:403659 14/66 (21%)
ABA_GPCR 276..446 CDD:403582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2496
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.