DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Drice

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster


Alignment Length:227 Identity:55/227 - (24%)
Similarity:102/227 - (44%) Gaps:27/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YKMQSRFNRGVLLMVNIMDYPDQN-RRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLT 250
            |.|:.: |||:.|:.|...:.... :.|.|...|.::|..:.::|:|.:..|.:.......:.:.
  Fly    86 YNMRHK-NRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIE 149

  Fly   251 MVTSSSYVQNTECFVMVLMTHGNS--VEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVL 313
            ...|.:: .:::|.::.:::||..  :..|:       :...:..|...|....||.|..|||:.
  Fly   150 YAASQNH-SDSDCILVAILSHGEMGYIYAKD-------TQYKLDNIWSFFTANHCPSLAGKPKLF 206

  Fly   314 MFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYV 378
            ....|:||..|.|            .|.|..:   |:|:|..|.|..:|..||.|:.|:..||:.
  Fly   207 FIQACQGDRLDGG------------VTMQRSQ---TETDGDSSMSYKIPVHADFLIAYSTVPGFY 256

  Fly   379 THRDLDTGSWYIQKFCQVMADHAHDTDLEDIL 410
            :.|:...|||::|..|..:|.:....|:..:|
  Fly   257 SWRNTTRGSWFMQSLCAELAANGKRLDILTLL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 55/227 (24%)
DriceNP_524551.2 CASc 86..330 CDD:214521 55/227 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.