DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Decay

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:246 Identity:66/246 - (26%)
Similarity:112/246 - (45%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 TYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLT 250
            ||:..:|  .|:.|::|..|...| ::|:|.|:|...:....|...|.:..:.::...:....|.
  Fly    48 TYENCAR--AGIALILNHKDVKGQ-KQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLK 109

  Fly   251 MVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMF 315
            .|....:.|| :|||:.:|:||  .|||   .:.......::::.:.|....|..|.||||:...
  Fly   110 EVAREDHSQN-DCFVLAVMSHG--TEGK---VYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFI 168

  Fly   316 PFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNV-------PSLADTLVCYAN 373
            ..|||           .||.:.|   :...:.....|.:|.|:..|       ||.||.||.|:.
  Fly   169 QACRG-----------ANLEKAV---EFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYST 219

  Fly   374 TPGYVTHRDLDTGSWYIQKFCQVM----ADHAHDTDLEDILKKTSEAVGNK 420
            ...:.:.|::|.|||:||..|:|:    |:.|...:..::|:..: ||..|
  Fly   220 FDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLT-AVNRK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 66/246 (27%)
DecayNP_477462.1 CASc 54..302 CDD:237997 64/240 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450669
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.