DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Damm

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:100/247 - (40%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 MVNIMDYP-DQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTEC 263
            ::|...:| |....|.|:..|..:|...|:.|...:....|.........:...::..:.|:.. 
  Fly    42 ILNHEQFPQDSQLNRKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAG- 105

  Fly   264 FVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDH--FQTAKCPYLVNKPKVLMFPFCRGDEYDLG 326
            ||:.:::||   :.|||:..||.....:.   |.  |...:.|.|..|||:|:...|:|      
  Fly   106 FVLFILSHG---DRKEKILACDHREYHLD---DDVLFPLFRNPTLSGKPKILIVQACKG------ 158

  Fly   327 HPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQ 391
                      |: .|..:|            ..|.|.:.    ||:.:.||:::|:.:.||.:||
  Fly   159 ----------PL-RADAKK------------MNNEPYIK----CYSCSEGYLSYRNENHGSVFIQ 196

  Fly   392 KFCQVMADHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLGFNKKLYF 443
            ..|:.|..:....|.:.|.|.....|..:.|..||.|..:.::..|:|..||
  Fly   197 TLCEAMDQYGLTRDFQSIFKHVKAEVERRSTMTGSKQVPSEESHNFDKPFYF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 56/245 (23%)
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 56/245 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.