DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Casp14

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001178705.1 Gene:Casp14 / 299587 RGDID:1311781 Length:246 Species:Rattus norvegicus


Alignment Length:242 Identity:61/242 - (25%)
Similarity:100/242 - (41%) Gaps:38/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 RRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLT--MVTSSSYVQNTECFVMVLMTHGN 273
            :.|.|:|.|..:|..:||.|.|......:....||...:.  ..|..::.:...|..:|||.||.
  Rat    31 KAREGSEVDMDALERMFQYLKFESTMKRDPTAQQFLDDMDEFQQTIENWKEPVSCAFVVLMAHGE 95

  Fly   274 SVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPV 338
              ||..|.|  ||::|.::.:.:......|..|..||||.:...|||:..|.|            
  Rat    96 --EGFLKGE--DGNMVRLEDLFEVLNNKNCKALRGKPKVYIIQACRGEHRDPG------------ 144

  Fly   339 YTAQEEKWPDTQTEGI--PSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHA 401
                 |:.|..:...|  .:|.| :|:..|.:..|:...|::::|....||.:||....|.. |.
  Rat   145 -----EELPGDELAVIKKKNPPT-IPTYTDMIHIYSTVEGFLSYRHDQKGSGFIQTLTDVFI-HK 202

  Fly   402 HDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLG------FNKKLY 442
            ..: :.::|::.:..:.|...    ||.|....:.      ..||||
  Rat   203 KGS-ITELLEEITRLMANTEV----MQEGKPRKVNPEIQSTLRKKLY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 61/242 (25%)
Casp14NP_001178705.1 CASc 10..246 CDD:237997 61/242 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1092723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.